GapMind for catabolism of small carbon sources

 

Alignments for a candidate for Ac3H11_2555 in Photobacterium jeanii R-40508

Align ABC transporter for L-Histidine, periplasmic substrate-binding component 1 (characterized)
to candidate WP_068333073.1 A3K86_RS15565 transporter substrate-binding domain-containing protein

Query= reanno::acidovorax_3H11:Ac3H11_2555
         (249 letters)



>NCBI__GCF_001650345.1:WP_068333073.1
          Length = 362

 Score = 55.8 bits (133), Expect = 1e-12
 Identities = 39/126 (30%), Positives = 60/126 (47%), Gaps = 1/126 (0%)

Query: 17  FCTTGAQ-AQDNVLRVGTDATFPPMEFVENGKRTGFDIELVEAIAKTMGKQVEWVDIDFK 75
           FC   A  +    + VG+    P +   E+G  TG  I+L + IA ++G   E    + K
Sbjct: 19  FCALFASPSHSKSINVGSYECPPFVMKNEDGTYTGLSIQLWQKIADSLGLSYEITSHELK 78

Query: 76  GLIPGLISKRFDMAVSAIYITDERKKVVDFTDSYYAGGLVVMVKADNKAINKLADLDGKK 135
            L+  + S   D+ VS I IT+ER+ V+DF+ S+Y   L + VK           L  KK
Sbjct: 79  PLLDDVASGAVDIGVSCISITEERELVLDFSHSFYETSLAIAVKEKGHLHTLFNILTNKK 138

Query: 136 VSVQVG 141
           +   +G
Sbjct: 139 LLTILG 144


Lambda     K      H
   0.317    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 158
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 249
Length of database: 362
Length adjustment: 27
Effective length of query: 222
Effective length of database: 335
Effective search space:    74370
Effective search space used:    74370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory