Align ABC transporter for L-Histidine, periplasmic substrate-binding component 1 (characterized)
to candidate WP_068333073.1 A3K86_RS15565 transporter substrate-binding domain-containing protein
Query= reanno::acidovorax_3H11:Ac3H11_2555 (249 letters) >NCBI__GCF_001650345.1:WP_068333073.1 Length = 362 Score = 55.8 bits (133), Expect = 1e-12 Identities = 39/126 (30%), Positives = 60/126 (47%), Gaps = 1/126 (0%) Query: 17 FCTTGAQ-AQDNVLRVGTDATFPPMEFVENGKRTGFDIELVEAIAKTMGKQVEWVDIDFK 75 FC A + + VG+ P + E+G TG I+L + IA ++G E + K Sbjct: 19 FCALFASPSHSKSINVGSYECPPFVMKNEDGTYTGLSIQLWQKIADSLGLSYEITSHELK 78 Query: 76 GLIPGLISKRFDMAVSAIYITDERKKVVDFTDSYYAGGLVVMVKADNKAINKLADLDGKK 135 L+ + S D+ VS I IT+ER+ V+DF+ S+Y L + VK L KK Sbjct: 79 PLLDDVASGAVDIGVSCISITEERELVLDFSHSFYETSLAIAVKEKGHLHTLFNILTNKK 138 Query: 136 VSVQVG 141 + +G Sbjct: 139 LLTILG 144 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 362 Length adjustment: 27 Effective length of query: 222 Effective length of database: 335 Effective search space: 74370 Effective search space used: 74370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory