Align lysine/arginine/ornithine ABC transporter, periplasmic lysine/arginine/ornithine-binding protein ArgT (characterized)
to candidate WP_068331602.1 A3K86_RS13005 transporter substrate-binding domain-containing protein
Query= CharProtDB::CH_003045 (260 letters) >NCBI__GCF_001650345.1:WP_068331602.1 Length = 257 Score = 209 bits (533), Expect = 4e-59 Identities = 107/259 (41%), Positives = 160/259 (61%), Gaps = 3/259 (1%) Query: 1 MKKTVLALSLLIGLGATAASYAALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMC 60 MKK +LA +++ LGAT+ Q +R G + Y PFS + GE GFD+D+ N +C Sbjct: 1 MKKWILAAAVVSALGATSVQAKEWKQ-IRFGIEGAYPPFSWTEPNGELKGFDVDMANALC 59 Query: 61 KRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAK 120 K ++ KC VA D+D +IPSL A+K DAII+++SIT++R++++ F+ K ++ +A K Sbjct: 60 KELKAKCKIVAQDWDGIIPSLLARKYDAIIAAMSITEERKKKVDFTGKYALIPNKFVAKK 119 Query: 121 GSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAA 180 G+ I T L G +GV + +T + Y DN+ K V++V Y + D Y DL AGR+ + Sbjct: 120 GTQIDFTEAGLDGVKIGVQRATTHDKYLTDNF--KSVEIVRYGSFDDAYLDLKAGRIASV 177 Query: 181 LQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELR 240 L D A EG L + G Y F GPS+ D K+FGDG G+ +RK D +L D+A+ LR Sbjct: 178 LGDASALEEGLLNKTGGDGYEFIGPSLTDPKWFGDGFGIAVRKQDKDLTKKLDEAILSLR 237 Query: 241 QDGTYDKMAKKYFDFNVYG 259 + G Y ++A KYF ++VYG Sbjct: 238 EKGIYQEIAAKYFAYDVYG 256 Lambda K H 0.315 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 257 Length adjustment: 24 Effective length of query: 236 Effective length of database: 233 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory