Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate WP_068333270.1 A3K86_RS15905 SDR family oxidoreductase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >NCBI__GCF_001650345.1:WP_068333270.1 Length = 252 Score = 139 bits (350), Expect = 6e-38 Identities = 90/267 (33%), Positives = 147/267 (55%), Gaps = 26/267 (9%) Query: 5 LNLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGG-------DKHQSSGNYNFWP 57 +++KE +I +TG G+G + L GA++ +ID++ H S + Sbjct: 1 MDIKESVIAITGAGQGLGQMMALTLAQAGADLALIDVNEAALRQTQDQCHMLSARAMVYK 60 Query: 58 TDISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVN 117 TD+++ +EV T +HII+ FG++DGL+NNAGV LLV +K +++ F+ ++ Sbjct: 61 TDVTNEAEVELTFNHIIEDFGQLDGLINNAGVLRDGLLVKQKDDE-LTKMSLEQFDLVMK 119 Query: 118 INQKGVFLMS-QAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSK 176 +N G FL +A A+ + +R GVI+N+SS + G+ GQ+ YAA+KAA+ + W+K Sbjct: 120 VNVNGTFLCGREAAAKMIATERQGVIINISSVARA-GNIGQTNYAASKAAVATMAVCWAK 178 Query: 177 ELGKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLT 236 EL ++GIR +APG++ KT + EA +E+L + +PLGR G Sbjct: 179 ELSRYGIRAAAIAPGVI-KTAMADQLKPEA--------IERL-----EKMVPLGRIGDAA 224 Query: 237 EVADFVCYLLSERASYMTGVTTNIAGG 263 E+A V ++L Y+TG I GG Sbjct: 225 EIAHTVKFILEN--DYLTGRVIEIDGG 249 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 252 Length adjustment: 24 Effective length of query: 243 Effective length of database: 228 Effective search space: 55404 Effective search space used: 55404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory