GapMind for catabolism of small carbon sources

 

Protein WP_068108069.1 in Nocardioides dokdonensis FR1436

Annotation: NCBI__GCF_001653335.1:WP_068108069.1

Length: 375 amino acids

Source: GCF_001653335.1 in NCBI

Candidate for 35 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 46% 71% 229.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 40% 91% 228.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
trehalose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 40% 91% 228.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
putrescine catabolism potA med spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 40% 86% 225.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
sucrose catabolism thuK med ABC transporter (characterized, see rationale) 41% 83% 222.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-cellobiose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 41% 77% 218.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-glucose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 41% 77% 218.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
lactose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 41% 77% 218.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-maltose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 41% 77% 218.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
sucrose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 41% 77% 218.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
trehalose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 41% 77% 218.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 41% 77% 218.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 46% 73% 213.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 46% 73% 213.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 41% 76% 205.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 40% 81% 205.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 40% 75% 186 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 44% 73% 146.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 45% 67% 218.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 37% 93% 218.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 39% 92% 211.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 45% 61% 208.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-mannitol catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) 38% 87% 206.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 40% 75% 206.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 39% 93% 205.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 37% 89% 204.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 65% 191.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 65% 191.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 65% 191.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 65% 191.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 65% 191.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 65% 191.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 65% 191.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 65% 191.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 42% 65% 191.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 44% 265.8

Sequence Analysis Tools

View WP_068108069.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTSTRTSAPVGAPTGPPAGPVLALSGVTKSYGSHPAVCGVDLAVSPGEVVTVIGPSGCGK
STLLRLAAGLERPDSGEVRVGGRVVAGSTWVPPERRRVGMVFQDHALFPHLDVAHNIAFG
LDELPRSQRAGRIAEVLELVGLGHLGQRHPHELSGGEQQRVALARALAPRPTVVLLDEPF
SSLDANLRTQVRTQTLAALRETGSAAMVVTHDQTEALSMGDRLAVLKDGVVRQVGTPSEV
YESPSSRFVASFMGDADFLPAHVRDALLTCEIGVVSTVPGWGHTDLDVEVMLRPHEVALR
VDGTSHDVVERVEYHGAFVLHHVRLASGRSVRSWQQHGVQHAPGTPVAVSVVPGSRPVLL
VGEDAVSAPPVGARR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory