Align 2-oxo-3-hexenedioate decarboxylase (EC 4.1.1.77) (characterized)
to candidate WP_084527059.1 I601_RS02755 2-keto-4-pentenoate hydratase
Query= BRENDA::B0VXM8 (267 letters) >NCBI__GCF_001653335.1:WP_084527059.1 Length = 308 Score = 150 bits (380), Expect = 2e-41 Identities = 88/239 (36%), Positives = 134/239 (56%), Gaps = 10/239 (4%) Query: 28 ARITEEVPDLSAEEAYKIQEELIKIKTNSGHRIIGPKMGLTSQAKMAQMKVKEPIYGYLF 87 A + + + AY +QE L +T +G R++G K+G TS+A Q+ V +P +G LF Sbjct: 43 APVRDLIGSTDVAAAYLVQEHLNATRTAAGARVVGRKIGATSEAVQTQLGVDQPDFGVLF 102 Query: 88 DYMFVPSGGAIHMSELIHPKVEVEIAFILGEDL-EGPHVTSTQVLSATKYVAPALEIIDS 146 D M P G I + L+ PKVE E+AF+L EDL EGP + QV A Y A+EI+DS Sbjct: 103 DDMGFPDGADIPVERLLQPKVEAEVAFVLSEDLAEGP-LDLAQVRGAIAYAVAAIEIVDS 161 Query: 147 RYQDFTFTLPDVIADNASSSRVVIG---NTMTPIHSLKTDLDLIGAALYINGELKACGAG 203 R QD+ + D +ADNASS V+G T+ + ++ + ++ I+GE + G G Sbjct: 162 RIQDWDISFADTVADNASSGLYVLGTQQRTLAEVEPVEVTM-----SMSIDGEEVSTGTG 216 Query: 204 AAVFNHPANSVAVLANMLARKGERLKAGDIILTGGITEAIQLSAGDTVIGQLDQLGDVS 262 AA P +VA LA+ GE L+AG ++L+G + ++ G TV+ ++ LG V+ Sbjct: 217 AACLGDPLKAVAWLAHQARTFGEPLRAGQVVLSGALGPMRAVTPGATVVAEISGLGSVT 275 Lambda K H 0.316 0.134 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 308 Length adjustment: 26 Effective length of query: 241 Effective length of database: 282 Effective search space: 67962 Effective search space used: 67962 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory