Align Acetate/butyrate--CoA ligase AAE7, peroxisomal; AMP-binding protein 7; AtAMPBP7; Acetyl-CoA synthetase; Acyl-activating enzyme 7; Butyryl-CoA synthetase; Protein ACETATE NON-UTILIZING 1; EC 6.2.1.1; EC 6.2.1.2 (characterized)
to candidate WP_068112231.1 I601_RS16760 fatty acid--CoA ligase
Query= SwissProt::Q8VZF1 (569 letters) >NCBI__GCF_001653335.1:WP_068112231.1 Length = 550 Score = 225 bits (573), Expect = 4e-63 Identities = 175/544 (32%), Positives = 262/544 (48%), Gaps = 45/544 (8%) Query: 34 VHPTRKSVIH---GSREYTWRQTYDRCRRLASALADRSIGPGSTVAIIAPNIPAMYEAHF 90 VHP ++ GSR ++ + +R RLA+AL + V N EA+ Sbjct: 22 VHPDGVAITATEGGSRSRSYSELGERTARLANALRGLGVDGDQRVGTFQWNNVEHLEAYL 81 Query: 91 GVPMCGAVLNCVNIRLNAPTVAFLLSHSQSSVIMVDQEFFTLAEDSLRLMEEKAGSSFKR 150 VP GAVL+ +NIRL + ++ +H+Q V++VD L L M + Sbjct: 82 AVPSMGAVLHTLNIRLFPEQLVYVANHAQDHVVIVDDSLVGLLAPHLGQM------TTVE 135 Query: 151 PLLIVIGDHTCAPESLNRALSKGAIEYEDFLATGDPNYPWQPPADEWQSIALGYTSGTTA 210 +++ D A RA K YED LA + W P DE + A+ YTSGTT Sbjct: 136 HVVVAGPDSADADLDALRATGKQVHLYEDLLAMQPTTFDW-PELDERDAAAMCYTSGTTG 194 Query: 211 SPKGVVLHHRGAYIMALS----NPLIWGMQDGAVYLWTLPMFHCNGWCFPWSLAVLSGTS 266 +PKGVV HR AY+ +L+ N +D + + +PMFH N W P+S A++SG S Sbjct: 195 NPKGVVYSHRSAYLHSLAVCGGNTTALSFEDRVLPI--VPMFHANAWGLPYS-AMMSGAS 251 Query: 267 ICL--RQVTAKEVYSMIAKYKVTHFCAAPVVLNAIVNAPKEDTILPLPHTVHVMTAGAAP 324 +CL R + A + I + + T P V N +++ + L V+ G+A Sbjct: 252 LCLPDRWLQADPLVRFIQESRPTLSGGVPTVWNDVLSHLDAHPEVALDSLRLVLCGGSAV 311 Query: 325 PPSVLFSMNQK-GFRVAHTYGLSETYGPSTVCAWKPEWDSLPP-----ETQAKLNARQGV 378 P S+ ++ ++ G V +G++ET ++ LPP E Q + QG Sbjct: 312 PVSLQQALQERHGLLVRQAWGMTETSPVASA--------GLPPVGCSEEEQWQYRGTQGR 363 Query: 379 RYTGMEQLDVIDTQTGKPVPADGKTAGEIVFRGNMVMKGYLKNPEANKET----FAGGWF 434 G+ V D QT +P DG++ GE+ RG V Y + E + F GW Sbjct: 364 LLCGVSARIVADDQT--VLPHDGRSVGELEVRGPWVTAAYYRPEEGERAEAEAKFHDGWL 421 Query: 435 HSGDIAVKHPDNYIEIKDRSKDVIISGGENISSVEVENVVYHHPAVLEASVVARPDERWQ 494 +GD+ YI + DR+KDVI SGGE ISSV++EN + H AVLEA+VVA PDE+WQ Sbjct: 422 RTGDVGHVDELGYISLTDRAKDVIKSGGEWISSVDLENALMAHEAVLEAAVVAIPDEKWQ 481 Query: 495 ESPCAFVTLKSDYEKHDQNKLAQDIMK-FCREKLPAYWVPKSVVFGPLPKTATGKIQKHI 553 E P A V ++ D +L + + + F + +LP W +P+T+ GK K + Sbjct: 482 ERPLASVVVR-DGATVTVEELREFLSRDFAKWQLPDTW----AFIDEVPRTSVGKFDKKV 536 Query: 554 LRTK 557 LR + Sbjct: 537 LRRR 540 Lambda K H 0.319 0.134 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 791 Number of extensions: 46 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 569 Length of database: 550 Length adjustment: 36 Effective length of query: 533 Effective length of database: 514 Effective search space: 273962 Effective search space used: 273962 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory