Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate WP_157520500.1 I601_RS08985 ABC transporter permease subunit
Query= reanno::pseudo1_N1B4:Pf1N1B4_3432 (229 letters) >NCBI__GCF_001653335.1:WP_157520500.1 Length = 255 Score = 88.2 bits (217), Expect = 1e-22 Identities = 59/195 (30%), Positives = 99/195 (50%), Gaps = 12/195 (6%) Query: 15 LTLQLALSSMVLAIVLGLIGVALRLSPIRW---LAWLGDLYSTVIRGIPDLVLILLIFYG 71 + +Q+A+ + VL +V+GL +RL P R L W+ LY V R IP ++++ L+ +G Sbjct: 47 VNIQVAVGAQVLVLVVGLALAVMRLLPGRAGRPLRWIATLYVDVFRAIPSIIVLYLVGFG 106 Query: 72 GQDLLNRVAPMFGYDDYIDLNPLAAGIGTLGFIFGAYLSETFRGAFMAIPKGQAEAGMAY 131 L P+ D +PL I L + AY++E +R +I Q A + Sbjct: 107 ---LSLAQVPIVR-----DFSPLWLAILALTLTYSAYVAEVYRAGIDSIHPSQWSASRSL 158 Query: 132 GMSSFQVFFRVLVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFKAKQAADATREP 191 G+S V+VPQ +R +P N+++ L K TALI V+G+ D +A+ + Sbjct: 159 GLSYSMTLRTVIVPQAVRRIVPPLLNDFIGLQKDTALIGVMGVTDAFMQARLVSSNVFN- 217 Query: 192 FTFFLAVAAMYLVIT 206 T + VA ++++IT Sbjct: 218 LTPVIVVAVLFVIIT 232 Lambda K H 0.329 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 255 Length adjustment: 23 Effective length of query: 206 Effective length of database: 232 Effective search space: 47792 Effective search space used: 47792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory