Align ABC transporter for L-Fucose, permease component 1 (characterized)
to candidate WP_068109004.1 I601_RS10140 sugar ABC transporter permease
Query= reanno::Smeli:SM_b21104 (298 letters) >NCBI__GCF_001653335.1:WP_068109004.1 Length = 316 Score = 149 bits (375), Expect = 1e-40 Identities = 94/284 (33%), Positives = 153/284 (53%), Gaps = 10/284 (3%) Query: 12 LLLPAFIVLAVFIVLPLIFSLYSSFTPFRLTKPDSLWVFIGFRNYVNVLTNAEFWVAFGR 71 L+ PA +V+ + P++ +LY S + LT P FIG NYV LT++ FW G Sbjct: 37 LVAPAIVVMLIVTAFPILRALYLSLYNYSLTAPADR-EFIGLSNYVTALTDSLFWRDIGV 95 Query: 72 TVLLLTVALNAEMFLGLGLALLVNKATYGQRALRTAMMFPMMFSPVLVGFQFKFLFNDNI 131 TVL + V + E+ +G AL++++ + + +RT+++ P V+ GF ++F F Sbjct: 96 TVLYMVVTVAIELVIGFAFALVMHRVIFARGLIRTSILIPYGIITVVSGFAWQFAFTYQN 155 Query: 132 GFVNNALQSLGLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAILILAGLLAMPKDPVEA 191 GFVN L + W A+ +I+V+E+W +T ++L+LAGL + +D VEA Sbjct: 156 GFVNGWLPFIA---DDFNWFGSPPPAIIAIMVSEIWKTTPFMSLLLLAGLAQVSEDMVEA 212 Query: 192 AHVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKIMTDGGPAKRTELLWTL 251 A VDG T WQ V P + +A+ R+LD R +D + +MT G A+ TE + L Sbjct: 213 AKVDGATWWQRMWKVVLPNMKAAIMVAVLFRALDAYRIFDNIFVMTAG--AQGTESISFL 270 Query: 252 IGRTAYGDARMGMANAMA---YVAILLSIFFTVYFFR-KLAAAR 291 R + ++GM +A+A ++++LL + V F+ LA AR Sbjct: 271 TYRQSIEQFQLGMGSALAVLLFLSVLLVAWLIVKMFKVDLAQAR 314 Lambda K H 0.331 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 316 Length adjustment: 27 Effective length of query: 271 Effective length of database: 289 Effective search space: 78319 Effective search space used: 78319 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory