Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate WP_068105462.1 I601_RS01380 aldehyde dehydrogenase family protein
Query= metacyc::MONOMER-16244 (495 letters) >NCBI__GCF_001653335.1:WP_068105462.1 Length = 506 Score = 317 bits (812), Expect = 6e-91 Identities = 176/483 (36%), Positives = 268/483 (55%), Gaps = 17/483 (3%) Query: 23 LFINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAFHSS-WSTSDPQ 81 L+I+ + + T P+ + V E +D AV AA +AF + W + Sbjct: 4 LYIDGTWRDAADGATRDIHCPADGHHVVTVSEGGEQDAVAAVVAARSAFDNGPWPHTPAP 63 Query: 82 VRMKVLYKLADLIDEHADTLAHIEALDNGKSLMCSKGDVALTAAYFRSCAGWTDKIKGSV 141 R +L++LAD ++ D +A +E+LD GK + S+ DV + FR A G V Sbjct: 64 ERAALLHRLADRLEADKDEVARLESLDTGKRFVESQIDVDDIVSVFRHFASLAQGEAGRV 123 Query: 142 IETGDTHF-NYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLSAL 200 ++ G + EPIGVC I PWN+PLL SWK+ P L G T +LK +E TP +A+ Sbjct: 124 VDAGMPGVVSRVVHEPIGVCTLITPWNYPLLQTSWKVAPCLAAGNTFILKPSELTPSTAI 183 Query: 201 YLASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAESNL 260 +L + +AG P GV N+V G G G ++ P++ V+FTG TGR +M AAA + + Sbjct: 184 WLMGALSDAGLPDGVANLVLGAGDRVGPTLTEAPEVDLVSFTGGVVTGRRVMVAAAPT-V 242 Query: 261 KKVTLELGGKSPNIVFDDADVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKIVSEF 320 KKV LELGGK+PN++F DAD+ + I + +T +F ++G+VC AG+R+ V++ ++D++V E Sbjct: 243 KKVALELGGKNPNVIFADADLDAAIDNALTAVFLDSGQVCSAGARLVVEDTVHDQVVDEL 302 Query: 321 KNAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGGERFGNKGY--- 377 A +++G PF +D G S DK+ Y+ G EGAT+ GG R GY Sbjct: 303 VRRAGRIRLGGPFDDDAETGPLISAAHRDKVEAYVAAGIAEGATLRVGGGRPEGAGYAAG 362 Query: 378 -----FIKPTIFGDVKEDHQIVRDEIFGPVVTITKF------KTVEEVIALANDSEYGLA 426 + PTI D D V++E FGPV+T+ +F E +++AND+ YGLA Sbjct: 363 LAEGFYYLPTILDDCSADMSCVQEESFGPVLTVERFTGEDADAREEAAVSIANDTVYGLA 422 Query: 427 AGVHTTNLSTAISVSNKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYTQV 486 V T++ A V++++ GTIW+N Y+ + +GGY QSG GRE+G L+ Y + Sbjct: 423 GAVWTSDAGRAERVASRLRHGTIWINDYHPYVAQAEWGGYKQSGTGRELGIAGLEEYRET 482 Query: 487 KAV 489 K + Sbjct: 483 KHI 485 Lambda K H 0.316 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 644 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 506 Length adjustment: 34 Effective length of query: 461 Effective length of database: 472 Effective search space: 217592 Effective search space used: 217592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory