Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate WP_068108588.1 I601_RS09280 amino acid ABC transporter permease
Query= TCDB::P48244 (228 letters) >NCBI__GCF_001653335.1:WP_068108588.1 Length = 216 Score = 141 bits (355), Expect = 1e-38 Identities = 76/214 (35%), Positives = 126/214 (58%), Gaps = 13/214 (6%) Query: 16 FWVTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTPLTLVVLFCSFGL 75 F ++ + ++ +G+++ GT++ RVSPV LR +A++ VRN PLT+V+ F +FGL Sbjct: 15 FLTSLGIIGWALVGSLLLGTLIAAFRVSPVASLRAFGSAWVTVVRNCPLTIVLFFMAFGL 74 Query: 76 YQNLGLTLAGRESSTFLVDNNFRLAVLGFILYTSTFVAESLRSGINTVHFGQAEAARSLG 135 + +G+ ++ + V+G I+YTS FV E++RSGIN+V GQAEAAR++G Sbjct: 75 PE-VGINVSF-----------YTFGVIGLIIYTSAFVCEAIRSGINSVSAGQAEAARAIG 122 Query: 136 LGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGEASLLMKATIENHANML 195 L F T ++ PQA+RA + PLG+ IA+ KN+ + GVG + + + Sbjct: 123 LPFTKTLTQVVLPQALRATVPPLGSVQIAMFKNSAVVGAFGVGGDLWSVGRNLTSAQGYA 182 Query: 196 FV-VFAIFAVGFMILTLPMGLGLGKLSERLAVKK 228 F+ V A+G++I+TL G L L ++A+ + Sbjct: 183 FIPVLTGVAIGYLIITLTAGALLAVLERKVAIAR 216 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 216 Length adjustment: 22 Effective length of query: 206 Effective length of database: 194 Effective search space: 39964 Effective search space used: 39964 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory