Align NatC aka SLL0146, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_068112897.1 I601_RS18180 branched-chain amino acid ABC transporter permease
Query= TCDB::P74455 (372 letters) >NCBI__GCF_001653335.1:WP_068112897.1 Length = 398 Score = 170 bits (431), Expect = 5e-47 Identities = 130/382 (34%), Positives = 203/382 (53%), Gaps = 35/382 (9%) Query: 14 ATYGIFALGLNLQWGFAGLINFGHVAFMTLGAYATTLLSLRGLPIPLAVLVGMGLAMALG 73 A I +GLN+ +GF GL+N G +M LGAY + +P+ LAVL+G+ +++ Sbjct: 21 AAVAIAVIGLNIHFGFTGLLNIGQAGYMLLGAYGMAISITYDIPLALAVLIGLVVSVLFS 80 Query: 74 LLIGTSTLRLREDYLAIVTIGVSELIRL---IANNEEWL--TQGTFGVQ----------- 117 L++G TL+LR DYLAIVTI +E+IR +A E++ +QG FG Sbjct: 81 LILGLPTLKLRGDYLAIVTISAAEIIRYTGRLAAFEDFTGGSQGIFGKNYQGPFMDLSFF 140 Query: 118 ---SFPW-PMDFNPTLLSRIVFVIWLTVLTIYAESILI--KSLLKQWKEGKKIQGKSYQP 171 SF P+ + +V V+ L V I+I K + E KI G S P Sbjct: 141 GDGSFELLPLSYRDAGGGDVVRVLGLLVAIAAIVGIVIIGKRMKAADGEAPKI-GTSATP 199 Query: 172 RKPLALLIWGIITTALILTAYVPGVVSLYNYSGKAGLMLLALTLLALTYAGLEFWVHSPW 231 + LA L G++ + ++ P + G + ++A +L+ ++ + V SPW Sbjct: 200 KLILAAL--GVVLFLALFFSF-PQSEPRTSVDGW-WVRVVAWSLVGISCIIVFLLVRSPW 255 Query: 232 GRILKAIREDEEIPRALGKNVFWYKLQAFMGGGAIAGLAGALFAWQLT-SIYPSNFDTLL 290 GR+L+ IREDEE R+LGKNVF K+QA + GG L G ++ LT S+ + L Sbjct: 256 GRLLRGIREDEEAMRSLGKNVFAIKMQALIIGGMFGALGGMVYV--LTGSVQADSMGRQL 313 Query: 291 TFNAWIIVVLGGAGSNAGTVLGTIIFWAYDSLTRFL----LPQIAFLDQSQAGALRVMVI 346 TF A+ ++LGGA + G VLG+++F++ L R + +P + + Q +V+ Sbjct: 314 TFFAYTALLLGGAATIFGPVLGSVLFFSARILVREMSGAYVPN-SIMSNQQTEQFSYVVV 372 Query: 347 GLILMVLMVWRPQGILGKKEEL 368 G+ L++L+++RPQGILG K EL Sbjct: 373 GVALVLLVIFRPQGILGNKREL 394 Lambda K H 0.327 0.143 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 398 Length adjustment: 30 Effective length of query: 342 Effective length of database: 368 Effective search space: 125856 Effective search space used: 125856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory