Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate WP_068110315.1 I601_RS12790 4-aminobutyrate--2-oxoglutarate transaminase
Query= reanno::Putida:PP_4108 (416 letters) >NCBI__GCF_001653335.1:WP_068110315.1 Length = 448 Score = 276 bits (707), Expect = 7e-79 Identities = 160/411 (38%), Positives = 221/411 (53%), Gaps = 6/411 (1%) Query: 6 ISQSIAIVHPITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLT 65 ++ + P+ ++ + D DG ID GI V ++G+ PAVV + AQ T Sbjct: 38 VADGVGTALPVFVTAAGGGVIVDVDGNSLIDLGSGIAVTSVGNAAPAVVRNVHAQVDAFT 97 Query: 66 HYAFNAAPHGPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGATGKRAIIAF 125 H F P+ Y+ + E L++ P + L NSGAEA ENA+K+AR ATGK A+ F Sbjct: 98 HTCFMVTPYEGYVDVCEALARLTPGEHAKKSALFNSGAEAVENAVKIARVATGKDAVAVF 157 Query: 126 DGGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLP--YPSADTGVTCEQALKAMDRLFS 183 D +HGRT T+ + K PYK G G VY P YP D E A +A+D L Sbjct: 158 DHAYHGRTNLTMAMTSKNMPYKHGFGPFAGEVYRAPMSYPLRDGLSGPEAAARAIDVL-D 216 Query: 184 VELAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRF 243 ++ ++A + EPV GEGGF+ F ALR +C +L++ DEIQ+GF RTG F Sbjct: 217 KQVGATNLACVVIEPVLGEGGFVVPASGFLPALREWCTANDVLLVADEIQTGFCRTGAWF 276 Query: 244 AFPRLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASL 303 A G+ PDL+ AK +AGG+PL AV GR ELM A+ GGLGGTY GNPI+CAAAL ++ Sbjct: 277 ACDDEGVVPDLVTSAKGMAGGLPLAAVTGRAELMDAVHAGGLGGTYGGNPIACAAALGAI 336 Query: 304 AQMTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEF-ANADGSPAPA 362 +M +LA E + R E A P + + G GAM +E A +P PA Sbjct: 337 EEMEGNDLAARAREIEALVRRRLEALAAE--HPVVAEVRGRGAMMAMELCAPGTTTPDPA 394 Query: 363 QLAKVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLA 413 + A A G++ + G ++ R L PLTI E+LEE D++ + A Sbjct: 395 RAAAASAYCHAHGVVTLTCGTWGNVFRFLPPLTISDELLEEAFDVVAEAFA 445 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 514 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 448 Length adjustment: 32 Effective length of query: 384 Effective length of database: 416 Effective search space: 159744 Effective search space used: 159744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory