Align Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate WP_068114710.1 I601_RS10135 carbohydrate ABC transporter permease
Query= TCDB::Q72KX4 (268 letters) >NCBI__GCF_001653335.1:WP_068114710.1 Length = 277 Score = 139 bits (350), Expect = 7e-38 Identities = 87/272 (31%), Positives = 153/272 (56%), Gaps = 9/272 (3%) Query: 5 LLYGFLLLMAGFFLLPVYLVVLTALKEPARITLETVWQW-PHPPY--WESFRTAWE--AF 59 L+ G LL++ + LLPV ++ + K A ++ T + P + W+++ + + F Sbjct: 7 LMIGVLLVLV-WCLLPVVWIISLSFKSQAAVSGGTDPGFLPLDSFTGWDNYSSVLQDDQF 65 Query: 60 RPKFQNSVVLAVSATLLSALVGSLNGYVLAKWPFRGSGLLFALILFGMFIPYQSILIPLF 119 R NS+ +++ ATLLS ++ +L Y +A+ F+G L+ + L P S++ PLF Sbjct: 66 RRAIINSIGISLIATLLSVIIATLAAYAIARLEFKGKKLVLTISLAIAMFPVVSLVSPLF 125 Query: 120 QFMKSIGLYGSLFGLVLVHVIYGIPIVTLIFRNYYSEIPDELVEAARIDGAGFFGIFRHV 179 ++IGLY + GL+L ++ + +P+ ++ EIP E+ +AA++DGA + FR V Sbjct: 126 DLWRTIGLYDTWPGLILPYMSFTLPLAIWTLSAFFREIPWEMEQAAQVDGATSWQAFRKV 185 Query: 180 ILPLSVPAFVVVAIWQFTQIWNEFLFAVTLTRPE-SQPITVALAQLAGGEAVK--WNLPM 236 I+PL+ P AI F WN+F+F +TLT E ++PI AL+ G + + L Sbjct: 186 IVPLAAPGVFTAAILTFFFAWNDFVFGITLTSTENARPIPAALSFFVGPDPFQRPAGLLA 245 Query: 237 AGAILAALPTLLVYILLGRYFLRGLLAGSVKG 268 A A++A +P +L+ ++ R + GL +G+VKG Sbjct: 246 AAAVVATIPIVLIVLVFQRKIVAGLTSGAVKG 277 Lambda K H 0.330 0.146 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 277 Length adjustment: 25 Effective length of query: 243 Effective length of database: 252 Effective search space: 61236 Effective search space used: 61236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory