Align 1-phosphofructokinase; EC 2.7.1.56; Fructose 1-phosphate kinase (uncharacterized)
to candidate WP_084527958.1 I601_RS02165 carbohydrate kinase
Query= curated2:P23386 (316 letters) >NCBI__GCF_001653335.1:WP_084527958.1 Length = 295 Score = 57.8 bits (138), Expect = 3e-13 Identities = 74/246 (30%), Positives = 100/246 (40%), Gaps = 26/246 (10%) Query: 38 AGGKGVNVASFLAHVGHGVA-VTGLLGAENAALFARHFAATGLVDACQ-RLPGATRTNVK 95 AGG NVA LA +G V T E AL ARH A G+ A + T T Sbjct: 23 AGGSAANVAVALARLGRPVRFATAYADDERGALLARHLAGAGVRLASDPHVVRRTSTAEA 82 Query: 96 IV--DPLQDQVTDLNFP--GIAAGPADLDAVAATLTELLAQGLDWVALCGSLPAGIGAEA 151 + D V DL++ + P L +L ++A G + V EA Sbjct: 83 TIGTDGGASYVFDLDWRLGEVPQDPTPLALHVCSLGAVVAPGAEAVVRL--------VEA 134 Query: 152 YAELAALARKGGARVALDTSGPALGLA---LAARPDIVKPNVAELGAHLGRTLTGLESVR 208 + R A+ +GP + L A D+VK + +L L + V Sbjct: 135 LRARTTITYDVNMRPAVTGAGPEVVEQVERLVALADLVKVSDEDL-----EVLLPMLGVE 189 Query: 209 EAARDLAASGVGLVAVSMGAGGAVLVRGAEAVLAIPPATPIASTVGAGD----AMVAGLI 264 +AAR L + G V ++ GA GA A AV P A +A T+GAGD A+V GL Sbjct: 190 DAARRLLSLGPRAVVLTRGAEGATWWSEAGAVDVSPRAVEVADTIGAGDTFAAALVDGLW 249 Query: 265 HAATLG 270 H LG Sbjct: 250 HLDLLG 255 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 295 Length adjustment: 27 Effective length of query: 289 Effective length of database: 268 Effective search space: 77452 Effective search space used: 77452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory