Align glucose transporter, ATPase component (characterized)
to candidate WP_068105520.1 I601_RS01500 methionine ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF3641 (260 letters) >NCBI__GCF_001653335.1:WP_068105520.1 Length = 347 Score = 111 bits (278), Expect = 2e-29 Identities = 76/241 (31%), Positives = 130/241 (53%), Gaps = 15/241 (6%) Query: 13 TPLVEMKDISISFGG-------IKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAY 65 +PL+ + D+S +F + A+D V +D+ GEV+G++G++GAGKSTL+++++ Sbjct: 4 SPLIRLADVSRTFPARSRQGAQVHALDRVDLDVAAGEVLGVVGYSGAGKSTLLRLVNALD 63 Query: 66 QMDAGEIRVNGDKVEITNPRDARS--HNIETIYQTLALADNLDAASNLFLGRELVTPFGL 123 + +G + V G +V + RD R +I I+Q L + N+ ++ Sbjct: 64 RPTSGTVTVAGREVSSLSERDLREVRRDIGMIFQQFNLFGSRTVWGNIAYPLQVAG---- 119 Query: 124 VDDSAMEAECRKIMNRLNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAA 183 V A ++++ + K + LSGGQ+Q V IARA+ + +IL+ DEPT+A Sbjct: 120 VPKQQHRARISELLHFVG-LADKAHAHIEQLSGGQKQRVGIARALATSPRILLADEPTSA 178 Query: 184 LGPHETQMVAELIQQLKAQ-GIGIFLIDHDVNAVMELCDRASVMKNGQLVGTVDIDDVTD 242 L P T V L++++ + G+ I LI H++ V L R +VM+ G++V T D DV Sbjct: 179 LDPQTTSEVLALLRRVNEELGVTIVLITHEMEVVRSLAHRVAVMEAGRVVETGDTYDVFA 238 Query: 243 D 243 D Sbjct: 239 D 239 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 347 Length adjustment: 27 Effective length of query: 233 Effective length of database: 320 Effective search space: 74560 Effective search space used: 74560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory