Align ABC transporter for Xylitol, permease component 1 (characterized)
to candidate WP_068109004.1 I601_RS10140 sugar ABC transporter permease
Query= reanno::Dino:3607126 (288 letters) >NCBI__GCF_001653335.1:WP_068109004.1 Length = 316 Score = 165 bits (417), Expect = 1e-45 Identities = 90/273 (32%), Positives = 151/273 (55%), Gaps = 6/273 (2%) Query: 14 IGPAVIGLALVGIAPLLYALWTSLHFYNLTKLRRVEFIGLENYWTVLTDEVFWQAMGRTF 73 + PA++ + +V P+L AL+ SL+ Y+LT EFIGL NY T LTD +FW+ +G T Sbjct: 38 VAPAIVVMLIVTAFPILRALYLSLYNYSLTAPADREFIGLSNYVTALTDSLFWRDIGVTV 97 Query: 74 FLLGTALPLQIALGLGIALVLHQPGLTLVKTLARLSLVLPMATTYAVVGLLGQVMFNQKF 133 + + +++ +G ALV+H+ + + L R S+++P V G Q F + Sbjct: 98 LYMVVTVAIELVIGFAFALVMHR--VIFARGLIRTSILIPYGIITVVSGFAWQFAFTYQN 155 Query: 134 GVVNQLLG--GADINWIGDPENAFAMIIFWDVWQWTPFVALVLLAGLTMVPGEVEEAARL 191 G VN L D NW G P A I+ ++W+ TPF++L+LLAGL V ++ EAA++ Sbjct: 156 GFVNGWLPFIADDFNWFGSPPPAIIAIMVSEIWKTTPFMSLLLLAGLAQVSEDMVEAAKV 215 Query: 192 ETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFDMVFTLTRGGPGSSTEFISLMIQR 251 + + W + V LP + ++ ++ R D ++FD +F +T G G TE IS + R Sbjct: 216 DGATWWQRMWKVVLPNMKAAIMVAVLFRALDAYRIFDNIFVMTAGAQG--TESISFLTYR 273 Query: 252 VGFRGFDQGLASAQAIILLIITIVLAQIYIRVF 284 F G+ SA A++L + +++A + +++F Sbjct: 274 QSIEQFQLGMGSALAVLLFLSVLLVAWLIVKMF 306 Lambda K H 0.329 0.144 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 316 Length adjustment: 27 Effective length of query: 261 Effective length of database: 289 Effective search space: 75429 Effective search space used: 75429 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory