GapMind for catabolism of small carbon sources

 

Protein WP_061059305.1 in Hafnia paralvei ATCC 29927

Annotation: NCBI__GCF_001655005.1:WP_061059305.1

Length: 523 amino acids

Source: GCF_001655005.1 in NCBI

Candidate for 9 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-maltose catabolism malF hi Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 77% 100% 812.4 MalF1; aka Maltose ABC transporter, permease protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins 35% 290.0
D-maltose catabolism malF1 lo MalF1; aka Maltose ABC transporter, permease protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 35% 87% 290 Maltose-transporting ATPase (EC 3.6.3.19) 77% 812.4
trehalose catabolism malF1 lo MalF1; aka Maltose ABC transporter, permease protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 35% 87% 290 Maltose-transporting ATPase (EC 3.6.3.19) 77% 812.4
D-maltose catabolism malF_Aa lo Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) 36% 77% 179.1 Maltose-transporting ATPase (EC 3.6.3.19) 77% 812.4
D-maltose catabolism malF_Sm lo MalF, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 32% 58% 144.1 Maltose-transporting ATPase (EC 3.6.3.19) 77% 812.4
trehalose catabolism malF lo MalF, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 32% 58% 144.1 Maltose-transporting ATPase (EC 3.6.3.19) 77% 812.4
D-maltose catabolism thuF lo Trehalose/maltose transport system permease protein MalF (characterized) 34% 81% 137.5 Maltose-transporting ATPase (EC 3.6.3.19) 77% 812.4
trehalose catabolism thuF lo Trehalose/maltose transport system permease protein MalF (characterized) 34% 81% 137.5 Maltose-transporting ATPase (EC 3.6.3.19) 77% 812.4
sucrose catabolism thuF lo ABC transporter for D-Trehalose, permease component 1 (characterized) 31% 68% 114.4 Maltose-transporting ATPase (EC 3.6.3.19) 77% 812.4

Sequence Analysis Tools

View WP_061059305.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSLSHTEYPIAKPDKWWQSDILKWIVIAAMCLFTGYLTIVMYAQGEYLFAMLTLVLLGSG
LYIFANRKAYAWRYVYPGLAGMGLFVLFPLICTIAIAFTNYSSTNQLTFERAQSVLMQRQ
FTTGKTYGFGLYPEGNQWRLQLADSENGQFYISEPFSFSAQEQRLAMKPESAELTGERAT
LRVITQNRQALNNIVAVLPQNGELRMSSLRQFAGTSPLYSLEKDGETLKNNQTGTLYRPN
TDIGFYQAVNAQGQWENEQLSPGFTVSIGWKNFMRVVQDEGIRQPFVSIFIWTIIFSVLT
VVFTVAVGMVLACVVQWEALKGKAVYRVMLILPYAVPSFISILIFKGLFNQSFGEINMLL
SHLFGIKPAWFSDPLTAKSMILIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPM
QNFFRITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDMLGTSTPAGYTDLLVSYT
YRIAFEGGGGQDFGLAAAIATLIFLLVGALAILNLKASKMNFD

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory