Align homoisocitrate dehydrogenase (EC 1.1.1.87) (characterized)
to candidate WP_004094577.1 M988_RS03500 3-isopropylmalate dehydrogenase
Query= BRENDA::Q5SIJ1 (334 letters) >NCBI__GCF_001655005.1:WP_004094577.1 Length = 363 Score = 174 bits (442), Expect = 2e-48 Identities = 124/348 (35%), Positives = 184/348 (52%), Gaps = 27/348 (7%) Query: 3 YRICLIEGDGIGHEVIPAARRVLEAT----GLPLEFVEAEAGWETFERRGTSVPEETVEK 58 + I ++ GDGIG E++ A + ++A GL + E + G ++ GT +P T+ Sbjct: 5 HHIAVLPGDGIGPEIMAQAYKTIDAVRQRFGLRISTSEYDVGGAAIDKHGTPLPAATIAG 64 Query: 59 ILSCHATLFGAATSPT-RKVPGFF----GAIRYLRRRLDLYANVRPAKSR-------PVP 106 A LFG+ P +P GA+ LR+ L++N+RPA+ P+ Sbjct: 65 CEQASAILFGSVGGPKWENLPPAQQPERGALLPLRKHFKLFSNLRPARLYEGLEEFCPLR 124 Query: 107 G--SRPGVDLVIVRENTEGLYVEQERR-----YLDVAIADAVISKKASERIGRAALRIAE 159 + G D++ VRE T G+Y Q + + A V + ERI R A A Sbjct: 125 SDIAARGFDILCVRELTGGIYFGQPKGREGQGMHERAFDTEVYHRFEIERIARIAFEAAR 184 Query: 160 GRPRKTLHIAHKANVLPLTQGLFLDTVKEVAKDFPLVNVQDIIVDNCAMQLVMRPERFDV 219 R K I KANVL + L+ + E+ KD+P V + + +DN MQL+ P +FDV Sbjct: 185 KRRGKVTSI-DKANVLQ-SSILWREIATEIGKDYPDVALNHMYIDNATMQLIKDPSQFDV 242 Query: 220 IVTTNLLGDILSDLAAGLVGGLGLAPSGNIGDT-TAVFEPVHGSAPDIAGKGIANPTAAI 278 ++ +N+ GDILSD A + G +G+ PS ++ + ++EP GSAPDIAGK IANP A I Sbjct: 243 MLCSNIFGDILSDECAMITGSMGMLPSASLNEQGFGLYEPAGGSAPDIAGKNIANPIAQI 302 Query: 279 LSAAMMLDY-LGEKEAAKRVEKAVDLVLERGPRTPDLGGDATTEAFTE 325 LS A++L Y L +AA VE+AV+ LE+G RT DL GD + +E Sbjct: 303 LSFALLLRYSLNADDAANAVEQAVNKALEQGFRTGDLAGDGQAISTSE 350 Lambda K H 0.319 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 18 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 363 Length adjustment: 29 Effective length of query: 305 Effective length of database: 334 Effective search space: 101870 Effective search space used: 101870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory