Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_008813822.1 M988_RS07760 L-cystine ABC transporter ATP-binding protein YecC
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >NCBI__GCF_001655005.1:WP_008813822.1 Length = 260 Score = 236 bits (601), Expect = 5e-67 Identities = 124/250 (49%), Positives = 172/250 (68%), Gaps = 7/250 (2%) Query: 1 MYKLEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKI 60 M +EV++L K + + VL GV L G+V++IIG SGSGK+T LR INLLE+P G I Sbjct: 1 MSTIEVKNLTKSFNGNTVLHGVDLTVEKGEVVAIIGPSGSGKTTLLRSINLLEEPDGGTI 60 Query: 61 LLNNEELKLVANKDGALKAADPKQ-LQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVL 119 + + + DG + K ++++R + VFQ+FNL+ H T +ENI+E PV V Sbjct: 61 QVGDVTI------DGGQPLSRQKTAIRKLRQEVGFVFQNFNLFPHRTVLENIIEGPVIVK 114 Query: 120 GMSKAEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSA 179 G + +A LAKVG+ ++DA+P +SGG+QQRVAIARALAM+PEV+LFDEPTSA Sbjct: 115 GEKREVVIARARELLAKVGLKGKEDAFPKRLSGGQQQRVAIARALAMQPEVILFDEPTSA 174 Query: 180 LDPELVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVN 239 LDPELVG+VL ++ALA+E RTMV+VTHEM FAR+V+N+ +F+ +G + E G +E+ N Sbjct: 175 LDPELVGEVLSTIRALAEENRTMVIVTHEMSFARDVANRAIFMDEGRIVEQGAAKELFAN 234 Query: 240 PQSERLQQFL 249 PQ R + FL Sbjct: 235 PQHPRTKLFL 244 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 260 Length adjustment: 24 Effective length of query: 230 Effective length of database: 236 Effective search space: 54280 Effective search space used: 54280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory