Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate WP_008812969.1 M988_RS12740 arginine ABC transporter substrate-binding protein
Query= reanno::pseudo3_N2E3:AO353_03055 (258 letters) >NCBI__GCF_001655005.1:WP_008812969.1 Length = 243 Score = 164 bits (416), Expect = 1e-45 Identities = 95/251 (37%), Positives = 145/251 (57%), Gaps = 10/251 (3%) Query: 1 MKKLVLLGALALSVLSLPTFADEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEE 60 MKKL++ LA +S A E ++ A YPPF S + IVGFD D+ ALC++ Sbjct: 1 MKKLMVCALLA--GMSFTATAAET-IRFASSATYPPFESMDSNNQIVGFDMDLAKALCKQ 57 Query: 61 MKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTNKYYNTPARLVMKAGT 120 M+ C + Q FD LIPALK ++ DA++S M IT +R+K V FT YY A ++ + G Sbjct: 58 MQATCTFTNQAFDSLIPALKFKRYDAVISGMDITPERQKQVAFTQPYYANSAIIIAEKGK 117 Query: 121 QVSDNLAELKGKKIGVQRGSIHNRFAEEVLKPLGAEIKPYGSQNEIYLDVAAGRLDGTVA 180 A++KG ++G++ G+ H ++ ++ K + Y S LD+ +GRLDG Sbjct: 118 Y--KTFADMKGLRVGMENGTTHQKYLQD--KHPEIKTVAYDSYQNAILDLKSGRLDGVFG 173 Query: 181 DATLLDDGFLKTDSGKGFAFVGPAFTDEKYFGDGIGIAVRKGDKAELDKINAAIVAIRAN 240 D ++++ +LK S A VG TD +YFG G+GIAVR + A L ++N A+ I+AN Sbjct: 174 DTAVVNE-WLK--SNPNLAAVGDHVTDAQYFGTGLGIAVRPENTALLAQLNKALDEIKAN 230 Query: 241 GKYKQIQDKYF 251 G Y++I ++F Sbjct: 231 GTYQKINQQWF 241 Lambda K H 0.318 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 243 Length adjustment: 24 Effective length of query: 234 Effective length of database: 219 Effective search space: 51246 Effective search space used: 51246 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory