Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate WP_004090757.1 M988_RS15845 tagatose bisphosphate family class II aldolase
Query= BRENDA::I3EBM6 (285 letters) >NCBI__GCF_001655005.1:WP_004090757.1 Length = 284 Score = 232 bits (592), Expect = 6e-66 Identities = 128/287 (44%), Positives = 170/287 (59%), Gaps = 7/287 (2%) Query: 1 MPLVSMTEMLNKAKAEGYAVGQFNLNNLEFTQAILLAAEEEKSPVILGVSEGAGRYMG-G 59 M L+S EML KA+ EGYAV FN++NLE Q ++ A KSPVIL + G Y G Sbjct: 1 MYLISNREMLKKAQREGYAVPAFNVHNLETVQVVVETAAALKSPVILAGTPGTFTYAGTD 60 Query: 60 FKTVVNMVKGLMEDYKITVPVAIHLDHGSSFEKCKEVIDAGFTSVMIDASHHPFEENVEV 119 + + + D +P+A+HLDH E + + AG SVMID SH+ FEEN+ Sbjct: 61 YLVSICQEAAHLHD----LPLALHLDHHEDLEDIRTKVMAGVRSVMIDGSHYAFEENIRT 116 Query: 120 TKKVVEYAHARGVSVEAELGTVGGQEDDVIADGV--IYADPKECEELVKRTGIDCLAPAL 177 +VV VSVEAELG +GGQEDD+ D + DP E V+RTGID LA A+ Sbjct: 117 VAEVVRLCQRYDVSVEAELGRLGGQEDDLNVDSADSFFTDPASAREFVERTGIDSLAVAI 176 Query: 178 GSVHGPYKGEPNLGFKEMEEIGRITGVPLVLHGGTGIPTKDIQRAISLGTAKINVNTENQ 237 GS HG Y GEP+L F + E+ + VPLVLHG +GIP ++ AI LG K+NV T+ + Sbjct: 177 GSAHGLYHGEPHLDFARLAEVRNVVDVPLVLHGASGIPEHMVREAIGLGICKVNVATDLK 236 Query: 238 IASAKKVREVLAENPNMYDPRKYLGPARDAIKETVIGKMREFGSSGK 284 IA A V+ E+P+ DPRKY+ P + A+ + V+ K+R GS GK Sbjct: 237 IAFADAVKSYFTEHPDANDPRKYITPGKQAMHDVVVEKIRICGSEGK 283 Lambda K H 0.314 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 284 Length adjustment: 26 Effective length of query: 259 Effective length of database: 258 Effective search space: 66822 Effective search space used: 66822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory