Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate WP_008815709.1 M988_RS20750 glutamine--fructose-6-phosphate transaminase (isomerizing)
Query= reanno::pseudo3_N2E3:AO353_04455 (336 letters) >NCBI__GCF_001655005.1:WP_008815709.1 Length = 610 Score = 127 bits (320), Expect = 6e-34 Identities = 98/309 (31%), Positives = 156/309 (50%), Gaps = 21/309 (6%) Query: 41 VARGSSDHAASYFAYLTMQHVGIPVASLPMSVVTMQQAPLKVSGQAVFAFSQSGQSPDLV 100 +A G+S H+ Y G+P S +++ ++ + SQSG++ D + Sbjct: 300 IACGTSYHSGMVARYWFESLAGVPCDVEIASEFRYRKSAVR-KNSLIITLSQSGETADTL 358 Query: 101 NSLRLLRKRGAL-SISMVNAENSPLEAACEFSLPLCAGTESSVAATKSFIATLSASARLI 159 +LRL ++ G L S+++ N +S L + +L AGTE VA+TK+F L+ L+ Sbjct: 359 AALRLSKEIGYLGSLAICNVASSSLVRESDLALMTKAGTEIGVASTKAFTTQLTVLLMLV 418 Query: 160 AYW--------KQDPELLQAGLALPEGLRDAATQDWS---LAVDVLRDCQRLMVIGRGAG 208 A K + +++ A ALP + + D LA D + D Q + +GRG Sbjct: 419 ARIGRLHTMPEKVEQDIVHALQALPARIEQMLSMDQGIEDLAEDFM-DKQHALFLGRGDQ 477 Query: 209 FAIAQEAALKLKETSAIQAEAFSSAEVKHGPMALIDDNYPLLVFAPRGAEQAGLLSLAAE 268 + IA E ALKLKE S I AEA+++ E+KHGP+ALID + P++V AP L S E Sbjct: 478 YPIAMEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVVVIAPNNELLEKLKSNIEE 537 Query: 269 MRQRGARVLLAAPDDVSERD------LTLSRAEHPALDPILAIQSFYVMAAGLAVARGMD 322 +R RG + + A D D ++L E + PI +++ +A+ +G D Sbjct: 538 VRARGGLLYVFADKDAGFTDSEGMRIISLPHVEE-VIAPIFYTVPLQLLSYHVALIKGTD 596 Query: 323 PDQPRHLSK 331 DQPR+L+K Sbjct: 597 VDQPRNLAK 605 Lambda K H 0.318 0.130 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 610 Length adjustment: 33 Effective length of query: 303 Effective length of database: 577 Effective search space: 174831 Effective search space used: 174831 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory