Align D-galactosamine-6-phosphate deaminase AgaS; GalN-6-P deaminase; Glucosamine-6-phosphate deaminase; GlcN-6-P deaminase; EC 3.5.99.-; EC 3.5.99.6 (characterized)
to candidate WP_064575374.1 M988_RS19180 hypothetical protein
Query= SwissProt::A0KYQ7 (386 letters) >NCBI__GCF_001655005.1:WP_064575374.1 Length = 392 Score = 174 bits (442), Expect = 3e-48 Identities = 127/390 (32%), Positives = 195/390 (50%), Gaps = 26/390 (6%) Query: 14 SNLLLSAEQLTQYGAFWTAKEISQQPKMWRKVSEQHSDNRTIAAWLTPILAKPQLRIILT 73 SN L S + G T + I QP++WR+ +R LA IIL Sbjct: 5 SNTLFSEAEWQSAGGLLTLQSICNQPRLWREGFALIQQHRAEIRRFWQQLADEPRNIILC 64 Query: 74 GAGTSAYIGDVLAAHIQQHLPLATQQVEAISTTDIVSHPELYLRGNIPTLLISYGRSGNS 133 GAG+S V A I+Q + ++ +++TDIV PELYL N PTLL+S SG++ Sbjct: 65 GAGSSLSAARVAAQWIRQQ---TGKSIQVLASTDIVVKPELYLE-NKPTLLVSVTSSGST 120 Query: 134 PESMAAVELAEQLVDDCYHLAITCNGQGKLANYCADKSHCYLYKLPDETHDVSFAMTSSF 193 PES A ELAE+L+DDCYHL + + QG+L + P T + SFA + F Sbjct: 121 PESTAVFELAERLIDDCYHLIVANDPQGELPKRSQHHAKTLYIPAPIGTKNGSFAAAAEF 180 Query: 194 TCMYLATLLIFAPN-----SQALMQCIEMAEHILTERLADIRLQSEQPSKRVVFLGGGPL 248 T LLIF P +AL A++ L+++ I +++ + VV LG L Sbjct: 181 TLPIWYLLLIFLPQQWDIAQRALDVYQHGADYFLSQQADKIAAIAKRDAPMVVSLGSSSL 240 Query: 249 KAIAQEAALKYLELTAGQVVSAFESPLGFRHGPKSLVDSHTQVLVMMSSDPYTRQYDNDL 308 + IA +A+LK LE+ G+ + S L FRHGPK +V+ V+ +S D +YD D+ Sbjct: 241 QFIAADASLKLLEMCNGRQATDDFSTLAFRHGPKLIVNQPVTVVCYLSPDQEILRYDLDM 300 Query: 309 IQELKR----DNQALSVLTLSEELLTGS------------SGLNEVWLGLPFILWCQILA 352 EL + + + ++E + + + L EV+ GL ++++ Q+L Sbjct: 301 ATELAAQRHPQGKIIGIYAANDERVAQACDEYLHFDSPELTQLPEVFSGLLYVMFAQLLG 360 Query: 353 IYKAIQLKVSPDNPCPTGQVNRVVQGVNVY 382 + +A QL V+PD P G+V +V + V +Y Sbjct: 361 LLRARQLGVTPDLPSNDGKVAKVCK-VTIY 389 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 392 Length adjustment: 30 Effective length of query: 356 Effective length of database: 362 Effective search space: 128872 Effective search space used: 128872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory