Align lysine/arginine/ornithine ABC transporter, periplasmic lysine/arginine/ornithine-binding protein ArgT (characterized)
to candidate WP_008814040.1 M988_RS06565 histidine ABC transporter substrate-binding protein HisJ
Query= CharProtDB::CH_003045 (260 letters) >NCBI__GCF_001655005.1:WP_008814040.1 Length = 260 Score = 394 bits (1013), Expect = e-115 Identities = 191/259 (73%), Positives = 224/259 (86%) Query: 1 MKKTVLALSLLIGLGATAASYAALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMC 60 MKK VLA+SL++ + +++ +AA+P +R+GTD TYAPFSSK+ +G+ +GFDIDL E+C Sbjct: 1 MKKQVLAVSLVLAMVGSSSVFAAVPDHLRVGTDPTYAPFSSKNPQGQLVGFDIDLAKELC 60 Query: 61 KRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAK 120 KR+ +CT+V SDFDALIPSLKAKKID IISSLSIT+KRQ+EIAF++KLYAADSRL+AAK Sbjct: 61 KRINTQCTFVESDFDALIPSLKAKKIDTIISSLSITEKRQKEIAFTEKLYAADSRLVAAK 120 Query: 121 GSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAA 180 GSPIQPTLESLKGKHVGVLQGSTQE YAN +WR +GVDVV Y NQDLIY+DL AGR+DAA Sbjct: 121 GSPIQPTLESLKGKHVGVLQGSTQETYANQHWRPQGVDVVPYQNQDLIYADLAAGRIDAA 180 Query: 181 LQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELR 240 QDEVAASEGFLKQP GK+YAFAGPSVKD FG GTG+GLRKDD +LK A DKA +R Sbjct: 181 FQDEVAASEGFLKQPVGKDYAFAGPSVKDNAIFGVGTGMGLRKDDADLKVALDKAFDSMR 240 Query: 241 QDGTYDKMAKKYFDFNVYG 259 +DGTYDK AKKYFDFNVYG Sbjct: 241 KDGTYDKFAKKYFDFNVYG 259 Lambda K H 0.315 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 260 Length adjustment: 24 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory