Align ABC transporter for L-Lysine, permease component 2 (characterized)
to candidate WP_004095864.1 M988_RS12735 arginine ABC transporter permease ArtM
Query= reanno::pseudo5_N2C3_1:AO356_09910 (229 letters) >NCBI__GCF_001655005.1:WP_004095864.1 Length = 222 Score = 157 bits (397), Expect = 2e-43 Identities = 87/215 (40%), Positives = 137/215 (63%), Gaps = 3/215 (1%) Query: 6 IIKWLPKLAQGATLTLELVAIAVIAGLLLAIPLGIARSSRLWQVRALPYAYIFFFRGTPL 65 + +++P + QG +L L I+++ L+LA+ I + R + L YI F GTPL Sbjct: 1 MFEYIPDIIQGLPTSLSLTIISLLVALVLALLFTIVLTLRPVVLTQLVQGYITLFTGTPL 60 Query: 66 LVQLFLVYYGLAQFDAVRSSA-LWPYLRDPFWCATVTMTLHTAAYIAEILRGAIQAIPKG 124 LVQ+FL+YYG QFD ++ + LW L P+ CA V + L++AAY ++ GA++AIP G Sbjct: 61 LVQIFLIYYGPGQFDWIKQTPWLWNMLSQPWLCAMVALALNSAAYTTQLFYGAVKAIPSG 120 Query: 125 EIEAARALGMSRPKALFYIMLPRAARIGLPAYSNEVILMLKASALASTVTLLELTGMART 184 + ++ ALGMSR + L I+LP A + L +YSNEV+L+ K+++LA T+TL+E+ G ++ Sbjct: 121 QWQSCEALGMSRSQTL-RILLPFAFKRALSSYSNEVVLIFKSTSLAYTITLMEVMGYSQQ 179 Query: 185 IIARTYLPVEIFFAAGMFYLLMSFLLVQGFKQLER 219 + RTY V +F AAG+ YL ++ LL + +ER Sbjct: 180 MYGRTY-DVMVFGAAGVIYLCVNGLLTLIMRMVER 213 Lambda K H 0.331 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 222 Length adjustment: 22 Effective length of query: 207 Effective length of database: 200 Effective search space: 41400 Effective search space used: 41400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory