Align beta-Phosphoglucomutase (EC 5.4.2.6) (characterized)
to candidate WP_040012372.1 M988_RS10410 hexitol phosphatase HxpB
Query= BRENDA::P71447 (221 letters) >NCBI__GCF_001655005.1:WP_040012372.1 Length = 220 Score = 81.6 bits (200), Expect = 1e-20 Identities = 61/196 (31%), Positives = 100/196 (51%), Gaps = 7/196 (3%) Query: 3 KAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADK 62 +AV+FD+DG++ D+ + + +GI+ E L R D + K+ Sbjct: 7 EAVIFDMDGLLIDSEPLWTQGEHDVFSSLGIDVNAADIPETLG--LRIDLVVKLWYQRTP 64 Query: 63 KVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPF- 121 A + +E+ +R +++++D P + PG+ LK R +KI LASAS Sbjct: 65 WQGASQ-EEVTERIIRRVIELVRDTKP--LLPGVEHALKLCRQQGMKIGLASASPLYMLN 121 Query: 122 -LLEKMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKD 180 +LE N++ YFDA+ + SKP P++++ AAHA+GV P + LEDS G+ A K Sbjct: 122 DVLEMFNISQYFDAVVSAEALPYSKPHPEVYLNAAHALGVDPLNCVTLEDSFNGMIATKA 181 Query: 181 SGALPIGVGRPEDLGD 196 + I V PE++ D Sbjct: 182 ARMRSIVVPAPENIND 197 Lambda K H 0.316 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 221 Length of database: 220 Length adjustment: 22 Effective length of query: 199 Effective length of database: 198 Effective search space: 39402 Effective search space used: 39402 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory