Align Phosphoglucomutase/phosphomannomutase; PGM/PMM; EC 5.4.2.2; EC 5.4.2.8 (characterized)
to candidate WP_067475179.1 BJL86_RS04440 phosphoglucosamine mutase
Query= SwissProt::Q68BJ6 (456 letters) >NCBI__GCF_001659785.1:WP_067475179.1 Length = 455 Score = 226 bits (575), Expect = 2e-63 Identities = 159/464 (34%), Positives = 232/464 (50%), Gaps = 38/464 (8%) Query: 1 MGKLFGTFGVRGIANEEITPEFALKIGMAFGTLL-----------KREGRERPLVVVGRD 49 M ++FGT GVRG+AN+ +T + AL +G A ++L R+RPL V+GRD Sbjct: 1 MPRMFGTDGVRGLANKSLTVDLALSLGAAAASVLAFDPAADTGHESSRDRQRPLAVIGRD 60 Query: 50 TRVSGEMLKDALISGLLSTGCDVIDVGIAPTPAIQWATNHFNADGGAVITASHNPPEYNG 109 RVSGEML+ AL +GL S G DV+ VG PTPA+ T H A GA+I+ASHNP NG Sbjct: 61 PRVSGEMLESALAAGLASQGVDVMLVGQVPTPAVAHLTGHHQAALGAMISASHNPMPDNG 120 Query: 110 IKLLEPNGMGLKKEREAIVEELFFSEDFHRA--KWNEIGELRKEDIIKPYIEAIKNRVDV 167 IK G L E E +E+ + + I L +E + PY+E + V Sbjct: 121 IKFFAAGGRKLSDELEDRIEDALEARITGPTGNRVGRISRLDRETALAPYLEHLLGTV-- 178 Query: 168 EAIKKRRPF----VVVDTSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEEN 223 R P VVVD ++GA P + G +VV++NA PDG+ N + Sbjct: 179 -----RHPLAGLKVVVDCAHGAAFEAAPAAYAKAGAEVVAINAEPDGY--NINEGVGSTH 231 Query: 224 LKGFMEIVKALGADFGVAQDGDADRAVFIDENGRFIQGDKTFALVADAVLR--ENGGGLL 281 ++G V GA G+A DGDADR + +D +G + GD+ A++A + E L Sbjct: 232 IEGLQRAVVEHGAALGLAHDGDADRCLAVDASGALVGGDEIMAVLALGMSEAGELKDNTL 291 Query: 282 VTTIATSNLLDDIAKRNGAKVMRTKVGDLIVARALLENNGTIGGEENGGVIFPDFVLGRD 341 V T+ ++ L +G V+ TKVGD V L + ++GGE++G ++ P+ D Sbjct: 292 VATVMSNLGLHLGLTEHGISVVTTKVGDRYVLEKLADGEYSLGGEQSGHLVLPEHATTGD 351 Query: 342 GAMTTAKIVEIFAKSGKKFSELIDELPKYYQFKTKRHVEGDRKAIVA-KVAELAEKKGYK 400 G +T ++ A++GK +EL + Q V K V+ V EK+ Sbjct: 352 GTLTGLFLMARMAETGKSLAELAAVMTVMPQVLINVQVADKAKVSVSDSVKSAVEKEEAA 411 Query: 401 IDTTDGTKIIFDDGWVLVRASGTEPIIRIFSEAKSEEKAREYLE 444 + T G VL+R SGTE ++R+ EA+S + ARE E Sbjct: 412 LGET---------GRVLLRPSGTEQVVRVMVEAESHDVARESAE 446 Lambda K H 0.317 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 455 Length adjustment: 33 Effective length of query: 423 Effective length of database: 422 Effective search space: 178506 Effective search space used: 178506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory