Align phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (EC 5.4.2.2) (characterized)
to candidate WP_075844860.1 BJL86_RS05065 phosphomannomutase/phosphoglucomutase
Query= BRENDA::Q8PGN7 (450 letters) >NCBI__GCF_001659785.1:WP_075844860.1 Length = 464 Score = 296 bits (757), Expect = 1e-84 Identities = 178/449 (39%), Positives = 256/449 (57%), Gaps = 12/449 (2%) Query: 9 KAYDIRGRVPDELNEDLARRIGVALAAQLDQ---GPVVLGHDVRLASPALQEALSAGLRA 65 KAYD+RG V ++++ R +G + + VV+GHD+R +SP L A G+++ Sbjct: 19 KAYDVRGVVGEQIDAAFVRDVGASFGKLMGSEGAAQVVVGHDMRESSPELASAFGEGVQS 78 Query: 66 SGRDVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISSDTGLF 125 G DVI IGL T+++YF + G M TASHNP YNG+KL R A+P+ D+GL Sbjct: 79 QGLDVISIGLASTDQLYFASGTFDCPGA-MFTASHNPAKYNGIKLCRAGAKPVGQDSGLD 137 Query: 126 AIRDTVAADTAAPGEPTASEQSRTDKTAYLEHLLSYVDRSTLKPLKLVVNAGNGGAGLIV 185 I + A A P S R Y + L S VD S ++PLK+ V+AGNG G V Sbjct: 138 VISQELVAGVPAFDGPAGSLSERDVLEDYGQFLRSLVDLSGVRPLKVAVDAGNGMGGHTV 197 Query: 186 DLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKDNGADFGIAWDGDFDRC 245 + E ++ E DGNFPN NPL P+N + V++ GAD G+A+DGD DRC Sbjct: 198 PAVLNLPNLEITPLYFELDGNFPNHEANPLEPKNLVDLQQLVRERGADIGLAFDGDADRC 257 Query: 246 FFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVLCKSGH 305 F D G + + L+A+ LA++PG ++++ + E V EAGGI V + GH Sbjct: 258 FVVDENGDPVSPSAISALVARRALAQEPGATIIYNLITSHTVPEIVHEAGGIAVRTRVGH 317 Query: 306 AFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLVEARMQ 365 +FIK +M S AV+GGE SAH+YFREF ADSGM+ + + + R L++L+ A Sbjct: 318 SFIKGQMASTGAVFGGEHSAHYYFREFWGADSGMLAAMHVLAALGGQDRPLSELM-AEYS 376 Query: 366 KFPCSGEINFKVADAKASVAR---VMEHYASLSPELDYTDGISADFGQ--WRFNLRSSNT 420 ++ SGEIN ++ A+A R V + ++S + +D DGI+ D G+ W FN+R+SNT Sbjct: 377 RYEASGEINSELPSAEAQSERMEAVADMFSSRARAIDRLDGITIDLGEGTW-FNIRASNT 435 Query: 421 EPLLRLNVETRGDAALLETRTQEISNLLR 449 EPLLRLN E A + E T E+ ++R Sbjct: 436 EPLLRLNAEAPTRAGVDEL-TAEVLAIIR 463 Lambda K H 0.319 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 464 Length adjustment: 33 Effective length of query: 417 Effective length of database: 431 Effective search space: 179727 Effective search space used: 179727 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory