Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate WP_067475181.1 BJL86_RS04450 glutamine--fructose-6-phosphate transaminase (isomerizing)
Query= reanno::Caulo:CCNA_00453 (363 letters) >NCBI__GCF_001659785.1:WP_067475181.1 Length = 618 Score = 130 bits (327), Expect = 1e-34 Identities = 106/326 (32%), Positives = 156/326 (47%), Gaps = 28/326 (8%) Query: 56 QRLRANPPRVVVTCARGSSDHAATFARYLIETKAGVLTSSAGPSVSSVYDASPNLE-GAL 114 Q LR +V C GS+ H+ A+Y IE + S D P L+ L Sbjct: 293 QELRDIDKVFIVAC--GSAYHSGLVAKYAIEHWTRIPCEVEIASEFRYRD--PVLDRSTL 348 Query: 115 YLAISQSGKSPDLLAAVKAAKAAGAHAVALVNVVDSPLAALADEVIPLHAGPELSVAATK 174 +AISQSG++ D L AV+ AK+ A +A+ N + + AD V+ HAGPE+ VA+TK Sbjct: 349 VVAISQSGETADTLEAVRHAKSQKARVLAVCNTNGAQIPREADAVLYTHAGPEIGVASTK 408 Query: 175 SYIAALVAVTQLIAAWTEDAELTA----------ALQDLPTALA-AAWTLDWSLAVER-L 222 +Y+A +A L+ A T AL+ +P + LD + R L Sbjct: 409 AYLAQ-IAANYLVGLALAQARGTKFPDEVSAEFHALEQMPELIGQVVERLDQVRQIAREL 467 Query: 223 KTASNLYVLGRGVGFGVALEAALKFKETCGLHAEAFSAAEVLHGPMALVKDGFPALVFAQ 282 + ++ LGR VG+ ALE ALK KE +HAE F A E+ HGP+AL+++G P V Sbjct: 468 ADSKSVLFLGRHVGYPTALEGALKLKELAYMHAEGFPAGELKHGPIALIEEGLPVFVVMP 527 Query: 283 NDESRASVDEMAAG----LRARGASVLIAGGGGD------APDALPTLASHPVLEPILMI 332 R+ + ++ARGA +I GD A + + +L+P+L Sbjct: 528 PLHGRSLLHSKLISNIQEIKARGARTIIISAEGDEVVKPFADYLIEIPETTTLLQPLLST 587 Query: 333 QSFYRMANALSVARGYDPDSPPHLNK 358 + A ++ ARGYD D P +L K Sbjct: 588 IPYQAFAAEVAAARGYDVDKPRNLAK 613 Lambda K H 0.315 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 618 Length adjustment: 33 Effective length of query: 330 Effective length of database: 585 Effective search space: 193050 Effective search space used: 193050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory