Align 2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.2.1.85) (characterized)
to candidate WP_068863622.1 I603_RS07320 aldehyde dehydrogenase family protein
Query= metacyc::MONOMER-15108 (486 letters) >NCBI__GCF_001677335.1:WP_068863622.1 Length = 506 Score = 360 bits (923), Expect = e-104 Identities = 197/481 (40%), Positives = 288/481 (59%), Gaps = 14/481 (2%) Query: 13 HFIDGKFVPSLDGKTFDNINPATEEKLGTVAEGGAAEIDLAVQAAKKALNGPWKKMTANE 72 +FI G++V + + FDNI+P +++ VA G A +I+LA+ AA KA W + + E Sbjct: 21 NFIGGQWVAPVKCQYFDNISPVNGKRVCQVARGSAEDIELALDAAHKA-RAAWGRTSTTE 79 Query: 73 RIAVLRKVGDLILERKEELSVLESLDTGKPTWLSGSIDIPRAAYNFHFFSDYIRTITNEA 132 R +L ++ I + + L+++E++D GKP + + D+P A +F +F+ +R Sbjct: 80 RSNILNRIAQRIEDNLDLLALVETIDNGKPIRETTAADLPLAVDHFRYFAGALRAQEGGI 139 Query: 133 TQMDDVALNYAIRRPVGVIGLINPWNLPLLLMTWKLAPALAAGNTVVMKPAELTPMTATV 192 +++D + Y P+GV+G I PWN PLL+ WKLAPALAAGN VV+KPAE TPM+ V Sbjct: 140 SEIDHDTIAYHFHEPLGVVGQIIPWNFPLLMAVWKLAPALAAGNCVVLKPAEQTPMSIMV 199 Query: 193 LAEICRDAGVPDGVVNLVHGFGPNSAGAALTEHPDVNAISFTGETTTGKIIMASAAKTLK 252 L E+ D +P+GVVN+V+GFG AG L P + I+FTGETTTG++IM A++ L Sbjct: 200 LMEVIGDL-LPEGVVNVVNGFG-IEAGKPLATSPRIAKIAFTGETTTGRLIMQYASENLI 257 Query: 253 RLSYELGGKNPNVIFA------DSNLDEVIETTMKSSFINQGEVCLCGSRIYVERPAYEA 306 + ELGGK+PN+ FA D LD+ +E + +NQGEVC C SR + Y+ Sbjct: 258 PCTLELGGKSPNIFFADVMREDDDYLDKALEGFAMFA-LNQGEVCTCPSRALIHESIYDR 316 Query: 307 FLEKFVAKTKELVVGDPFDAKTKVGALISDEHYERVTGYIKLAVEEGGTILTGGKR--PE 364 F+EK +A+ + +G P DA T +GA S++ E++ YI++ EG +LTGG R E Sbjct: 317 FMEKAIARVNAIKLGSPLDAATMIGAQASNDQLEKILSYIEIGKGEGAKVLTGGGRHIHE 376 Query: 365 G-LEKGYFLEPTIITGLTRDCRVVKEEIFGPVVTVIPFDTEEEVLEQINDTHYGLSASVW 423 G L +GY+++PT++ G + R+ +EEIFGPV++V F +E L NDT YGL A VW Sbjct: 377 GELAEGYYVKPTVLEGHNK-MRIFQEEIFGPVLSVTTFKDNDEALSIANDTLYGLGAGVW 435 Query: 424 TNDLRRAHRVAGQIEAGIVWVNTWFLRDLRTPFGGMKQSGIGREGGLHSFEFYSELTNIC 483 + D +R IEAG VW N + FGG KQSGIGRE E Y + N+ Sbjct: 436 SRDANTCYRFGRAIEAGRVWTNCYHAYPAHAAFGGYKQSGIGRENHKMMLEHYQQTKNLL 495 Query: 484 I 484 + Sbjct: 496 V 496 Lambda K H 0.318 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 584 Number of extensions: 27 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 486 Length of database: 506 Length adjustment: 34 Effective length of query: 452 Effective length of database: 472 Effective search space: 213344 Effective search space used: 213344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory