Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate WP_068865576.1 I603_RS12545 phosphoglucosamine mutase
Query= BRENDA::Q6I7B6 (450 letters) >NCBI__GCF_001677335.1:WP_068865576.1 Length = 445 Score = 158 bits (399), Expect = 4e-43 Identities = 150/463 (32%), Positives = 234/463 (50%), Gaps = 45/463 (9%) Query: 2 RLFGTAGIRGTLWEKV-TPELAMKVGMAVGTY--KSG---KALVGRDGRTSSVMLKNAMI 55 +LFGT GIRG + V T AMKVG A G + + G + ++G+D R S M+++A++ Sbjct: 4 KLFGTDGIRGRTNDGVMTAATAMKVGQAAGRHFVRGGHRHRVVIGKDTRLSGYMMESALV 63 Query: 56 SGLLSTGMEVLDADLIPTPALAWGTRKL-ADAGVMITASHNPPTDNGVKVFNGDGTEFYV 114 +G S G++V+ +PTPA+A TR++ AD GVMI+ASHN DNG+K+F DG + Sbjct: 64 AGFTSVGIDVIMTGPLPTPAIALLTREMRADLGVMISASHNLFADNGIKLFGPDGFKLSD 123 Query: 115 EQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPD-YINAVLDFVGHETN---LKVLYDGA 170 E +E ++ + A + I R +E YI+AV V E LKV+ D A Sbjct: 124 AAEAEIERLMET-EIPLAPPERIGRARRIEDARGRYIHAVKQSVATEIRFDGLKVVVDCA 182 Query: 171 NGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQ 230 NGA VAP + E+GA V+++ +G IA L V E G D+ IA Sbjct: 183 NGAAYQVAPSAIWELGADVVTLGVTPNG--TNINDGVGSTAIAALQAKVVEEGADIGIAL 240 Query: 231 DGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHG---GGTVVVSIDTGSRIDAVVERAG 287 DGDADR+ V DEKG VD D ++AL A ++E G GG +V ++ + ++ + G Sbjct: 241 DGDADRLIVVDEKGRAVDGDQIMALIA-TRMQERGSLRGGGIVATVMSNLGLERYLAGLG 299 Query: 288 GRVVRIPLGQPHDGIKRYKA----IFAAEPWKLVHPKFGPWIDPFV-TMGLLIKLIDENG 342 +VR +G + ++ KA + + ++ + D V + +L L+ Sbjct: 300 LDLVRTKVGDRY-VLEAMKAGGYNVGGEQSGHMILLDYATTGDGTVAALRVLASLVRSGK 358 Query: 343 PLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSE-IKEVLTISGFRIALN 401 SEL+ +V P ++++ E + L +E +K V+ + +A Sbjct: 359 KASELL-----------HVFDP---VPQLLKNVRYEGGQPLENEGVKTVIAAAEAELA-- 402 Query: 402 DGSWILIRPSGTEPKIRVVAE----APTEKRRDELFEMAYSTV 440 ++IRPSGTEP IRV+AE A E+ D + E ++ V Sbjct: 403 GKGRLVIRPSGTEPVIRVMAEGDDQAQVERVVDTICEAVHAAV 445 Lambda K H 0.318 0.138 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 36 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 450 Length of database: 445 Length adjustment: 33 Effective length of query: 417 Effective length of database: 412 Effective search space: 171804 Effective search space used: 171804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory