Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_065400596.1 BBI00_RS19945 glucose 1-dehydrogenase
Query= BRENDA::Q4J702 (264 letters) >NCBI__GCF_001684965.1:WP_065400596.1 Length = 269 Score = 130 bits (327), Expect = 3e-35 Identities = 86/260 (33%), Positives = 124/260 (47%), Gaps = 10/260 (3%) Query: 8 SVKGMNAVVLGASSGIGKAIAEMFSEMGGKVVLSDIDE---EGLKRLSDSLRSRGHEVNH 64 S+ AVV GASSGIG IA+ + G VV++ E E K + + G Sbjct: 4 SLHNQVAVVTGASSGIGSGIAKCLAAAGAVVVVNHSSERSSEEAKAVLKEITDAGGNGIM 63 Query: 65 MKCDITDLNQVKKLVNFSLSVYGNVDALYVTPSINVRKSIENYTYEDFEKVINVNLKGNF 124 +CD++ +QV K+ ++ + VD L I T + + VI VNL G F Sbjct: 64 YQCDVSKEDQVVKMFQDVVAQFQTVDILINNAGIQKDAKFTEMTIDQWNAVIGVNLTGQF 123 Query: 125 M----VVKEFLSV---MKNNKGGGSVVLFSSIRGTVVEPGQSVYAMTKAGIIQLAKVAAA 177 + +KEFL +K G ++ SS+ + G + YA +K I L + A Sbjct: 124 LCAREAIKEFLRRGIDPSRSKACGKIIHISSVHEVIPWAGHANYASSKGAIRMLMQTLAQ 183 Query: 178 EYGKYNIRVNVIAPGVVDTPLTRQIKSDPEWFKAYTEKTILKRWATPEEIANVALFLAMP 237 EYG + IRVN I PG + TP+ + S PE + R P++I N+A FLA Sbjct: 184 EYGAHKIRVNSICPGAIQTPINKDAWSTPEALDSLLTLIPYNRIGQPQDIGNLAAFLASD 243 Query: 238 ASSYITGTVIYVDGGWTAID 257 + YITGT I+VDGG T + Sbjct: 244 LADYITGTSIFVDGGMTTFE 263 Lambda K H 0.317 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 269 Length adjustment: 25 Effective length of query: 239 Effective length of database: 244 Effective search space: 58316 Effective search space used: 58316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory