Align Probable NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Short chain dehydrogenase/reductase; YlSDR; EC 1.1.1.138 (characterized)
to candidate WP_065400596.1 BBI00_RS19945 glucose 1-dehydrogenase
Query= SwissProt::Q6CEE9 (278 letters) >NCBI__GCF_001684965.1:WP_065400596.1 Length = 269 Score = 112 bits (281), Expect = 7e-30 Identities = 83/259 (32%), Positives = 131/259 (50%), Gaps = 18/259 (6%) Query: 30 SLKGKVASITGSSSGIGFAVAEAFAQAGADVAIWYNSKPSDEKAEYLSKTY---GVRSKA 86 SL +VA +TG+SSGIG +A+ A AGA V + ++S+ S E+A+ + K G Sbjct: 4 SLHNQVAVVTGASSGIGSGIAKCLAAAGAVVVVNHSSERSSEEAKAVLKEITDAGGNGIM 63 Query: 87 YKCAVTNAKQVETTIQTIEKDFGKIDIFIANAGIPWTAGPMIDVPNNEEWDKVVDLDLNG 146 Y+C V+ QV Q + F +DI I NAGI A ++W+ V+ ++L G Sbjct: 64 YQCDVSKEDQVVKMFQDVVAQFQTVDILINNAGIQKDA--KFTEMTIDQWNAVIGVNLTG 121 Query: 147 AYYCAKYAGQIFKKQGYGSFIFTASMSGHIVNIPQM--------QACYNAAKCAVLHLSR 198 + CA+ A + F ++G + G I++I + A Y ++K A+ L + Sbjct: 122 QFLCAREAIKEFLRRGIDP--SRSKACGKIIHISSVHEVIPWAGHANYASSKGAIRMLMQ 179 Query: 199 SLAVEW-AGFARCNTVSPGYMATEISD--FIPRDTKEKWWQLIPMGREGDPSELAGAYIY 255 +LA E+ A R N++ PG + T I+ + + + LIP R G P ++ + Sbjct: 180 TLAQEYGAHKIRVNSICPGAIQTPINKDAWSTPEALDSLLTLIPYNRIGQPQDIGNLAAF 239 Query: 256 LASDASTYTTGADILVDGG 274 LASD + Y TG I VDGG Sbjct: 240 LASDLADYITGTSIFVDGG 258 Lambda K H 0.317 0.132 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 269 Length adjustment: 25 Effective length of query: 253 Effective length of database: 244 Effective search space: 61732 Effective search space used: 61732 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory