Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_065400596.1 BBI00_RS19945 glucose 1-dehydrogenase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_001684965.1:WP_065400596.1 Length = 269 Score = 133 bits (334), Expect = 4e-36 Identities = 87/262 (33%), Positives = 140/262 (53%), Gaps = 26/262 (9%) Query: 16 LDGRHALVTGGAQGIGFEIARGLAQAGARVTI---ADLNPDVGEGAAREL-----DGTFE 67 L + A+VTG + GIG IA+ LA AGA V + ++ + + + +E+ +G Sbjct: 5 LHNQVAVVTGASSGIGSGIAKCLAAAGAVVVVNHSSERSSEEAKAVLKEITDAGGNGIMY 64 Query: 68 RLNVTDADAVA----DLARRLPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFW 123 + +V+ D V D+ + VD+L+NNAGI ++A + D W AV+ VNL G F Sbjct: 65 QCDVSKEDQVVKMFQDVVAQFQTVDILINNAGIQKDAKFTEMTIDQWNAVIGVNLTGQFL 124 Query: 124 CCREFGRTMLARGR--------GAIVSTASMSGLI--SNHPQPQAAYNASKAAVIHLTRS 173 C RE + L RG G I+ +S+ +I + H A Y +SK A+ L ++ Sbjct: 125 CAREAIKEFLRRGIDPSRSKACGKIIHISSVHEVIPWAGH----ANYASSKGAIRMLMQT 180 Query: 174 LAGEWASRGVRVNAVAPGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYL 233 LA E+ + +RVN++ PG TP+ + TPE ++ L P R+ +P++I +L Sbjct: 181 LAQEYGAHKIRVNSICPGAIQTPINKDAWSTPEALDSLLTLIPYNRIGQPQDIGNLAAFL 240 Query: 234 ASDAASFVTGHTLVVDGGYTVW 255 ASD A ++TG ++ VDGG T + Sbjct: 241 ASDLADYITGTSIFVDGGMTTF 262 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 269 Length adjustment: 25 Effective length of query: 230 Effective length of database: 244 Effective search space: 56120 Effective search space used: 56120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory