Align sorbitol-6-phosphate dehydrogenase; EC 1.1.1.140 (characterized)
to candidate WP_065400596.1 BBI00_RS19945 glucose 1-dehydrogenase
Query= CharProtDB::CH_091827 (259 letters) >NCBI__GCF_001684965.1:WP_065400596.1 Length = 269 Score = 98.6 bits (244), Expect = 1e-25 Identities = 81/267 (30%), Positives = 136/267 (50%), Gaps = 20/267 (7%) Query: 2 NQVAVVIGGGQTLGAFLCHGLAAEGYRVAVVDIQSDKAANVAQEINAEYGESMAYG--FG 59 NQVAVV G +G+ + LAA G V VV+ S++++ A+ + E ++ G + Sbjct: 7 NQVAVVTGASSGIGSGIAKCLAAAG-AVVVVNHSSERSSEEAKAVLKEITDAGGNGIMYQ 65 Query: 60 ADATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLC 119 D + E V+ + + V F VD+L+ +AGI K A ++ + ++ + VNL G FLC Sbjct: 66 CDVSKEDQVVKMFQDVVAQFQTVDILINNAGIQKDAKFTEMTIDQWNAVIGVNLTGQFLC 125 Query: 120 AREFSRLMIRDGIQ-------GRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDL 172 ARE + +R GI G+II I+S + ++ Y+++K L Q+LA + Sbjct: 126 AREAIKEFLRRGIDPSRSKACGKIIHISSVHEVIPWAGHANYASSKGAIRMLMQTLAQEY 185 Query: 173 AEYGITVHSLMLGNLLKSPMFQSLLPQYATKLGIKPDQVEQYYIDKVPLKRGCDYQDVLN 232 + I V+S+ G +++P+ + ++T P+ ++ + +P R QD+ N Sbjct: 186 GAHKIRVNSICPG-AIQTPINKD---AWST-----PEALDS-LLTLIPYNRIGQPQDIGN 235 Query: 233 MLLFYASPKASYCTGQSINVTGGQVMF 259 + F AS A Y TG SI V GG F Sbjct: 236 LAAFLASDLADYITGTSIFVDGGMTTF 262 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 269 Length adjustment: 25 Effective length of query: 234 Effective length of database: 244 Effective search space: 57096 Effective search space used: 57096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory