Align lactoylglutathione lyase (EC 4.4.1.5) (characterized)
to candidate WP_065400523.1 BBI00_RS19475 methylmalonyl-CoA epimerase
Query= BRENDA::Q97H22 (128 letters) >NCBI__GCF_001684965.1:WP_065400523.1 Length = 132 Score = 57.4 bits (137), Expect = 7e-14 Identities = 42/131 (32%), Positives = 68/131 (51%), Gaps = 4/131 (3%) Query: 1 MKVHHIGYAVKNIDSALKKFKRLGYVEESEVVRDEVRKVYIQFVINGGYRVELVAPDGED 60 MK+ HIG AVK++ + F RL + + E V F G ++EL+ + Sbjct: 1 MKLEHIGIAVKSLGISDNLFARLLGKDSYKQETVEREGVVTSFYETGESKIELLEASNPE 60 Query: 61 SPINKTI-KKGSTPYHICYEVEDIQKSIEEMSQIGYTLFKKAEIAPAIDNRKVAFLF--S 117 SPI+K I KKG +H+ + VE+I + ++ + + G+ F E DN+ V FL S Sbjct: 61 SPISKFIEKKGEGIHHLAFGVENILQEVQRLKKEGFQ-FISEEPKEGADNKLVVFLHPKS 119 Query: 118 TDIGLIELLEK 128 T+ L+EL ++ Sbjct: 120 TNGVLVELCQE 130 Lambda K H 0.318 0.138 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 48 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 128 Length of database: 132 Length adjustment: 14 Effective length of query: 114 Effective length of database: 118 Effective search space: 13452 Effective search space used: 13452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 41 (20.4 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory