Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_065398591.1 BBI00_RS09790 ATP-binding cassette domain-containing protein
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_001684965.1:WP_065398591.1 Length = 342 Score = 122 bits (307), Expect = 8e-33 Identities = 75/233 (32%), Positives = 131/233 (56%), Gaps = 23/233 (9%) Query: 25 KAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVIFDGEPIQQLQPHQIA 84 KA+ + + + +G I G+IG +GAGK+TL ++ RPD+G++I +G+ +L Q+A Sbjct: 19 KALDKVSLNIEKGDIVGIIGFSGAGKSTLIRTVNLLERPDEGQIIINGKDFTKLNSRQLA 78 Query: 85 QQ----GMVRTFQVARTLSRLSVLENMLLAAQ-KQTGENFWQVQLQPQVVVKEEKQLQEQ 139 ++ GM+ FQ LS +V +N+ L + TG+ +Q+ + Sbjct: 79 EERKKIGMI--FQHFNLLSSRTVFDNVALPLELDHTGK----------------EQINRK 120 Query: 140 AMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDEPAAGVNPRLIDDIC 199 LL+ VGL +KA +Y LSGGQ++ + + RAL +P L+L DE + ++P I Sbjct: 121 VNELLKIVGLEEKANDYPRSLSGGQKQRVAIARALANDPHLLLCDEATSALDPATTQSIL 180 Query: 200 DRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTPAEIQTNSQ 252 + N++ G+T L+I H M+VI ++C+ V V+ +G+ L GT +EI ++ + Sbjct: 181 QLLRDINQRLGITILLITHEMEVIKTVCNHVAVIDKGKLLTKGTLSEIISDKE 233 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 342 Length adjustment: 26 Effective length of query: 234 Effective length of database: 316 Effective search space: 73944 Effective search space used: 73944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory