Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_066741880.1 BED41_RS00875 glucose 1-dehydrogenase
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >NCBI__GCF_001701045.1:WP_066741880.1 Length = 255 Score = 125 bits (315), Expect = 7e-34 Identities = 88/247 (35%), Positives = 133/247 (53%), Gaps = 13/247 (5%) Query: 17 VSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFPKLHAGIA-----DVSKQAQ 71 VS AGIG A A + + A+V + V + E T + K G A DVSK Sbjct: 12 VSGAGAGIGKAAACLYAKNGAKVVVA-VRTLSKGEETVKLIKEAGGEAILVHTDVSKLTD 70 Query: 72 VDQIIDDARRKLGGLDVLVNNAGIAGPTGAVEELDPAQWESTVSTNLNSQFYFLRKAVPV 131 + +I A G LD+L +NAG+ GP G ++E+ W+ TV+ NL S F+ + AV Sbjct: 71 LQDMIKTAVESYGRLDILFSNAGVPGP-GGLDEVTEEGWDQTVAVNLRSCFFSAKYAVEE 129 Query: 132 LKETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLAAELGPSNVRVNAILPGV 191 +++T A I+ SS+AG++G P Y++TK IV L KSLA L P N+RVN + PG Sbjct: 130 MRKTGGGA-IVFDSSIAGKVGSPMSPVYSATKGGIVTLTKSLALLLAPDNIRVNCVCPGP 188 Query: 192 VEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASPAGSNVTG 251 ++ + + + D +A R + ++L RM + +++A LFL+S S VTG Sbjct: 189 IDTKFVRQAWDRAPDP-----DAARLCNVSGVALGRMGSPEEVANAVLFLSSDESSYVTG 243 Query: 252 QAISVDG 258 A++VDG Sbjct: 244 TAMAVDG 250 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 255 Length adjustment: 24 Effective length of query: 239 Effective length of database: 231 Effective search space: 55209 Effective search space used: 55209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory