Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate WP_069958139.1 BEN30_RS09690 ATP-binding cassette domain-containing protein
Query= TCDB::P73721 (252 letters) >NCBI__GCF_001746755.1:WP_069958139.1 Length = 259 Score = 250 bits (638), Expect = 2e-71 Identities = 130/255 (50%), Positives = 176/255 (69%), Gaps = 8/255 (3%) Query: 1 MTSPTAPLISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPI 60 M PL+ + + K+FG VL+G++ DVISI+G SG GKSTFLRC+N LE Sbjct: 1 MPDDNTPLLKVEDIHKSFGGQDVLKGISVNANRGDVISILGSSGSGKSTFLRCINYLEHP 60 Query: 61 SGGRLEVAGVDL------SGAKI--DQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAP 112 GR+ +AG ++ SG+ + D K L +LR R+G VFQ FNL+PHL VLQN++ AP Sbjct: 61 DIGRVSIAGEEIRTKKDKSGSLVPADPKQLARLRARIGFVFQSFNLWPHLNVLQNVIEAP 120 Query: 113 RKVLRIPMAEAKDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDE 172 +VL++ +A +RA L +VGL + ++P LSGGQ+QR AIAR L M+PE++LFDE Sbjct: 121 MQVLKLSRKDATERAEVILARVGLADRMHHFPAHLSGGQQQRAAIARTLAMEPEVILFDE 180 Query: 173 PTSALDPELVGEVLNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNE 232 PTSALDPELV EVL V+ LAEEG TM +VTHEM FAREVS F +QG +EE+G P++ Sbjct: 181 PTSALDPELVSEVLAVIGSLAEEGRTMLIVTHEMGFAREVSTWTMFLHQGKVEEQGPPDK 240 Query: 233 VFRNPKSDRLRAFLS 247 +F+N S+R+R F++ Sbjct: 241 IFKNADSERVRQFMA 255 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 259 Length adjustment: 24 Effective length of query: 228 Effective length of database: 235 Effective search space: 53580 Effective search space used: 53580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory