Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_069957743.1 BEN30_RS07675 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQI0 (292 letters) >NCBI__GCF_001746755.1:WP_069957743.1 Length = 338 Score = 134 bits (338), Expect = 2e-36 Identities = 98/337 (29%), Positives = 166/337 (49%), Gaps = 56/337 (16%) Query: 1 MNLMLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAFIGYFL------- 53 M+ ++ Q++NGL G YAL+ALG T+ +G + ++NFAHG ++MMGAF + Sbjct: 1 MDAIVIQILNGLDKGGAYALIALGLTLAFGTLGIVNFAHGALFMMGAFCAVTVQKLLTIS 60 Query: 54 --INSFQMNFFVA--------------------------LIVAMLATAILGVVIEFLAYR 85 + + FF A +++A+ A++GVV+E R Sbjct: 61 ARVRDMSVTFFEAYKETPYLELWWGDTGTTIIEYSVPLSILIAIPVMALVGVVMERGLIR 120 Query: 86 PLRHSTRIAVLITAIGVSFLLEYGMVYLVGANTRAFPQAIQTV---RYDLGPISLTNVQL 142 T ++ G++ +++ + + GAN PQAI + ++G + + L Sbjct: 121 FFYKRTHAEQILVTFGLAIVIQEIIRHFFGANP--IPQAIPEIVSGSANVGTMLGLSDTL 178 Query: 143 MILGISLILMILLQVIV-------QKTKMGKAMRAVSVDSDAAQLMGINVNRTISFTFAL 195 + LI V++ Q T G +RA D D L+GIN+ R + FAL Sbjct: 179 VYPWWRLIYFCFATVVIGGVFAFLQYTTYGMVVRAGMADRDTVGLLGINIQRRFTIVFAL 238 Query: 196 GSALAGAAGVLIALYYNSLEP--LMGVTPGLKSFVAAVLGGIGIIPGAALGGFVIGLLET 253 + +AG AGV+ Y L P MG+ + SFV V+GG+G +PGA GF++G+L++ Sbjct: 239 AAVVAGLAGVM---YTPVLPPDYHMGMDFLVLSFVVVVVGGMGSLPGAVAAGFLLGILQS 295 Query: 254 FATAFGMSDF----RDAIVYGILLLILIVRPAGILGK 286 FA+ + F I+Y + ++I++VRP G++G+ Sbjct: 296 FASMNEIKQFLPGIDQIIIYLVAVVIILVRPRGLMGR 332 Lambda K H 0.330 0.146 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 3 Length of query: 292 Length of database: 338 Length adjustment: 27 Effective length of query: 265 Effective length of database: 311 Effective search space: 82415 Effective search space used: 82415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory