Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_079189056.1 RH94_RS16015 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_001906585.1:WP_079189056.1 Length = 305 Score = 179 bits (454), Expect = 6e-50 Identities = 100/249 (40%), Positives = 144/249 (57%), Gaps = 3/249 (1%) Query: 2 TLRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFL 61 TL + ++V+ +++ VSL++ G++ L+GPNG GKSTLL R L P SG V L Sbjct: 37 TLDIDGVSVTVDGRTLVDRVSLTVSPGEVVGLVGPNGAGKSTLLRTVYRALRPTSGRVLL 96 Query: 62 GDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNV 121 + + ++LAR L+ + Q H +TV E+V+ GR P + A D A V Sbjct: 97 DGADVWRMPGKRLARHLAAVLQEHAGDFELTVYEVVAMGRTPHKRPFAGDDAGDRAVVTA 156 Query: 122 AMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLM 181 A+ + + LA LSGG++QR +A LAQ ++LDEPT +LD+ HQ+D +RL Sbjct: 157 ALTELDVAGLADAPFDRLSGGEKQRVLIARALAQRAGTMVLDEPTNHLDLRHQLDALRL- 215 Query: 182 GELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEI 241 +R G T V LHDLN A+ +CD+L V+ G V+A GTP +V+TP LL V+ VEA + Sbjct: 216 --VRRLGVTAVVALHDLNLAASFCDRLCVLETGRVVAHGTPRDVLTPALLAEVYRVEAYV 273 Query: 242 HPEPVSGRP 250 P SG P Sbjct: 274 TEHPRSGAP 282 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 305 Length adjustment: 26 Effective length of query: 229 Effective length of database: 279 Effective search space: 63891 Effective search space used: 63891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory