Align lactaldehyde dehydrogenase (EC 1.2.1.22); D-glyceraldehyde dehydrogenase (NADP+) (EC 1.2.1.89) (characterized)
to candidate WP_073948994.1 RH94_RS20650 aldehyde dehydrogenase family protein
Query= BRENDA::P25553 (479 letters) >NCBI__GCF_001906585.1:WP_073948994.1 Length = 462 Score = 285 bits (730), Expect = 2e-81 Identities = 177/471 (37%), Positives = 254/471 (53%), Gaps = 25/471 (5%) Query: 9 MYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIER 68 MYIDG + G I+VVNPA E VI+ +P G AED A+ AA A P W A P ER Sbjct: 7 MYIDGAWRPAAGRDAIEVVNPADEQVIATVPAGTAEDVDAAVRAARAALPGWAATPPAER 66 Query: 69 ASWLRKISAGIRERASEISALIVEEGGKIQQLAE-----VEVAFTADYIDYMAEWARRYE 123 A+ L + + R EI+ + E G ++ V +A Y D A +A +E Sbjct: 67 AARLTALRDVLVARKDEIAETVTAELGSPLAFSQAVHAGVPIAVAGSYADLAATYA--FE 124 Query: 124 GEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPN 183 ++ N + +GV I PWN+P I K APAL G TIV+KP+E TP Sbjct: 125 EKV-------GNSTVHHEPVGVVGAITPWNYPLHQIVAKAAPALAAGCTIVLKPAEDTPL 177 Query: 184 NAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAAK 243 A FA+ E G+P GV NLV G G GQ LA +P V +VS TGS + G +I ATA Sbjct: 178 TAQLFAEAAHEAGIPAGVLNLVTGLGPVAGQALAEHPDVDLVSFTGSTAVGRRIGATAGA 237 Query: 244 NITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVN 303 + +V LELGGK+ +++ ADL AV V + + NSGQ C+ R+ V + YD+ V Sbjct: 238 AVKRVALELGGKSANVILPSADLARAVNVGVANVMSNSGQTCSAWTRMLVHRDQYDEAVE 297 Query: 304 RLGEAMQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVAFGG-KAVEGKG 362 A A ++G+ +GP++NA RV + + + EGAR+ GG +A KG Sbjct: 298 LAATA--AAKYGD-------RIGPVVNAKQRARVRGYIEKGIAEGARLVAGGPEAPCEKG 348 Query: 363 YYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNV 422 Y+ PT+ DV +M++ EE FGPVL ++ +D +DA+ +AN + YGL +++ + Sbjct: 349 YFVSPTVFADVTPDMTVAQEEIFGPVLSILRYDDEDDALRIANGTVYGLAGAVWAADETE 408 Query: 423 AMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQ 473 A+ + + G+ IN F + F G+++SG+G G HGL EYLQT+ Sbjct: 409 AVAFARRMDTGQVDINGGRFNPLAPF-GGYKQSGVGRELGAHGLTEYLQTK 458 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 462 Length adjustment: 33 Effective length of query: 446 Effective length of database: 429 Effective search space: 191334 Effective search space used: 191334 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory