Align protocatechuate 4,5-dioxygenase (subunit 1/2) (EC 1.13.11.8) (characterized)
to candidate WP_047212489.1 PATSB16_RS02570 protocatechuate 3,4-dioxygenase
Query= BRENDA::G2IQQ3 (302 letters) >NCBI__GCF_001931675.1:WP_047212489.1 Length = 280 Score = 336 bits (862), Expect = 3e-97 Identities = 152/280 (54%), Positives = 212/280 (75%), Gaps = 3/280 (1%) Query: 1 MARVTTGITSSHIPALGAAIQTGTSDNDYWGPVFKGYQPIRDWIKQPGNMPDVVILVYND 60 MAR+ GI +SH+PA+GAAI G + + YW P+F+G P R+W+ PD+ I++YND Sbjct: 1 MARIVAGIGTSHVPAIGAAIDHGKTADPYWRPLFEGVAPAREWLAAIA--PDIAIVIYND 58 Query: 61 HASAFDMNIIPTFAIGCAETFKPADEGWGPRPVPDVKGHPDLAWHIAQSLIL-DEFDMTI 119 HAS F +++ PTFA+G AETF P DEG+GPR VP +G+P+ AWH+A+SLIL D FD+ + Sbjct: 59 HASRFALDVTPTFALGMAETFAPHDEGYGPRAVPVCEGNPEFAWHLAESLILKDGFDLAM 118 Query: 120 MNQMDVDHGCTVPLSMIFGEPEEWPCKVIPFPVNVVTYPPPSGKRCFALGDSIRAAVESF 179 +++M VDHG TVPLS++FG+P WPC+VIP VNV+ YP P+ +RC LG ++R A++S+ Sbjct: 119 VSEMTVDHGLTVPLSLLFGQPTRWPCQVIPLCVNVIQYPQPTAQRCHQLGQALRRAIDSY 178 Query: 180 PEDLNVHVWGTGGMSHQLQGPRAGLINKEFDLNFIDKLISDPEELSKMPHIQYLRESGSE 239 D V V+GTGGMSHQLQG RAGLIN ++D ++D++ +DP L+ + H + LRE+GSE Sbjct: 179 APDAKVAVFGTGGMSHQLQGERAGLINPDYDRMWLDRMETDPGSLAVIGHAELLREAGSE 238 Query: 240 GIELVMWLIMRGALPEKVRDLYTFYHIPASNTALGAMILQ 279 G+E++MWLIMRGAL E VR ++ FYH+PASNTA G + L+ Sbjct: 239 GLEIIMWLIMRGALDEAVRRVHRFYHVPASNTAYGLLALE 278 Lambda K H 0.319 0.138 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 280 Length adjustment: 26 Effective length of query: 276 Effective length of database: 254 Effective search space: 70104 Effective search space used: 70104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory