Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_052892752.1 PATSB16_RS19085 branched-chain amino acid ABC transporter ATP-binding protein/permease
Query= uniprot:G8ALJ0 (294 letters) >NCBI__GCF_001931675.1:WP_052892752.1 Length = 598 Score = 186 bits (472), Expect = 1e-51 Identities = 118/266 (44%), Positives = 155/266 (58%), Gaps = 14/266 (5%) Query: 11 LLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTL 70 +L V FGGLVAVNDVSF GEI +IGPNGAGK+T FN +TG T G +T Sbjct: 342 ILDVRAARKEFGGLVAVNDVSFQVKAGEIVGLIGPNGAGKSTTFNLVTGVLQATSGEITF 401 Query: 71 RHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNK-----LIRAS 125 H + + L R K + RTFQ++RL MSVLEN+ + H + R Sbjct: 402 -HGERIDKLASRE-----IVKRGIGRTFQHVRLLPTMSVLENVAIGAHLRDRQGLRRRPQ 455 Query: 126 GFSIAGLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCT 185 G + +L L E + A ++RV L E EAG+L G QR LEIARA+ Sbjct: 456 GGVWSSVLRLD--RAEEAMLMHEAARQIERVGLGEHMYEEAGSLALGQQRILEIARALAC 513 Query: 186 EPVMLCLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYG 245 +P +L LDEPAAGL +E LA+LL + DE + VLL+EHDM VM ++DH+VV+++G Sbjct: 514 DPTLLLLDEPAAGLRYKEKQALAELLRKLSDE-GMSVLLVEHDMDFVMNLTDHLVVMEFG 572 Query: 246 RKISDGDPAFVKNDPAVIRAYLGEEE 271 KI++G P V+ DPAV+ AYLG E Sbjct: 573 TKIAEGLPEDVQKDPAVLEAYLGGVE 598 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 598 Length adjustment: 32 Effective length of query: 262 Effective length of database: 566 Effective search space: 148292 Effective search space used: 148292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory