Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.110) (characterized)
to candidate WP_156884539.1 PATSB16_RS00570 FAD-binding protein
Query= BRENDA::H6LBS1 (466 letters) >NCBI__GCF_001931675.1:WP_156884539.1 Length = 510 Score = 232 bits (592), Expect = 2e-65 Identities = 155/466 (33%), Positives = 244/466 (52%), Gaps = 25/466 (5%) Query: 11 IAAIKELIPAERVFVGTEIGEDFSHDELGSIHSYPEVLIKVTSTEEVSKIMKYAYEHNIP 70 +AA+K L+ ERV + E DE P+ + STEEV +I++ +++P Sbjct: 58 LAALKALL-GERVSTAAAVREHHGRDESPFDPIAPDAVAYAHSTEEVVQIVRLCARYDVP 116 Query: 71 VVVRGSGTGLVGACVPLFGGIMLETTLMNNILELDTENLTVTVEPGVLLMELSKFVEEND 130 ++ G+G+ L G + + GG+ ++ + MN I+ ++ E+LTVTV+PG+ L++ + + Sbjct: 117 IIPYGAGSSLEGHLLAVQGGLTIDLSEMNQIVSVNAEDLTVTVQPGISRKTLNEGLRDTG 176 Query: 131 LFYPPDPGEKSATIAGNISTNAGGMRAVKYGVTRDYVRGLTVVLANGEIIELGGKIVKNS 190 LF+P DPG A+I G +T A G AV+YG R+ V GLTVVLA+G +I+ G + K+S Sbjct: 177 LFFPIDPGA-DASIGGMCATRASGTNAVRYGTMRENVLGLTVVLADGRVIKTGSRARKSS 235 Query: 191 SGYSLKDLVIGSEGTLCVITKAILKLLPLPKMTLSLLIPFENISDAAGIVPKIIKSKAIP 250 +GY L L +GSEGTL +IT+A ++L P P+ + + F ++ DA V + I+ Sbjct: 236 AGYDLTRLFVGSEGTLGIITEATVRLYPQPEAVSAAVCAFSSMGDAVQCVIETIQLGVPV 295 Query: 251 TAIEFMERQTILFAEDFLGKKFPDSSSNAYILLTFDGNTKEQVEAEYETVANLCLAEGAK 310 +EF++ I KF + S + F G + V + ETV L G + Sbjct: 296 ARVEFVDGLAIRAINQH--SKFTLTESPT-LFFEFHG-SPTGVHEQAETVQALASEHGGQ 351 Query: 311 DVYIVDTVERKDSVWSARG----AFLE---AIKASTTEMDECDVVVPRNRIAEFIEFTHD 363 E + +WSAR A L+ +A TT DV VP +R+ E + T Sbjct: 352 GFEWATQQEERSRLWSARHNAYFAMLQLKPGCRAVTT-----DVCVPISRLTECVVETEQ 406 Query: 364 LAKEMDVRIPSFGHAGDGNLHIYVCRDELCQADWEAKLAEA---MDRMYAKALTFEGLVS 420 K + P GH GDGN H+ + L D +L EA R+ +A+ G + Sbjct: 407 DLKASPLPCPIVGHVGDGNFHVAI----LVDPDKPEELLEAERLNQRIVERAIAMGGTCT 462 Query: 421 GEHGIGYAKRKYLLNDFGTEHLALMAGIKQTFDPKNLLNPKKVCQM 466 GEHG+G K +L+++ G + + +M IK DP+NLLNP K+ +M Sbjct: 463 GEHGVGLHKMGFLVSEHGEDAIDVMRSIKAALDPRNLLNPGKIFRM 508 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 510 Length adjustment: 34 Effective length of query: 432 Effective length of database: 476 Effective search space: 205632 Effective search space used: 205632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory