Align AotJ aka PA0888, component of Arginine/ornithine (but not lysine) porter (characterized)
to candidate WP_156884837.1 PATSB16_RS06995 transporter substrate-binding domain-containing protein
Query= TCDB::O50181 (259 letters) >NCBI__GCF_001931675.1:WP_156884837.1 Length = 257 Score = 109 bits (273), Expect = 5e-29 Identities = 81/258 (31%), Positives = 134/258 (51%), Gaps = 20/258 (7%) Query: 6 LLGALALSVLSLPTFAADKP-VRIGIEAAYPPFSLKTPDGQLAGFDVDIGNALCEEMKVQ 64 ++ LA SV + AA K + +G + +PPF + +G++ GFD+D+ A+ + + Sbjct: 1 MIAGLAFSVCATTASAAGKTSIVVGADTTFPPFETEV-NGKVTGFDIDMIEAIAKAEGMT 59 Query: 65 CKWVEQEFDGLIPALKVRKIDAILSSMTITDERKRSVDFTNKYYNTPARFVMKEGASLND 124 + F+G+IP+L+ +DA ++ +TI R +SVDF++ YY + ++K+ + + D Sbjct: 60 VEIKTMPFNGIIPSLQAGSVDAAVAGITIKKSRMQSVDFSDAYYKSGLSVLVKKDSKIKD 119 Query: 125 PKADLKGKKAGVLRGSTADRYASAELTPAGVE---VVRYNSQQEANMDLVAGRLDAVVAD 181 ADLKG + +++ Y +T G++ + ++ A L G DAVV D Sbjct: 120 -FADLKGHVVATKKATSSVDY----MTSHGIDPNYIKQFQDIDTAYQALETGGADAVVFD 174 Query: 182 S-VNLEDGFLKTDAGKGYAFVGPQLTDAKYFGEGVGIAVRKGDSELAGKFNAAIDALRAN 240 + VN+ KT A VGP LT GE GIAV K D L K N + ++ + Sbjct: 175 NPVNVN---FKT-AHPNVKVVGPLLT-----GEYYGIAVSKKDPTLVKKINDGLAKIKKS 225 Query: 241 GKYKQIQDKYFSFDVYGS 258 G+Y Q+ KYF DV G+ Sbjct: 226 GEYHQLFVKYFGGDVSGA 243 Lambda K H 0.316 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 257 Length adjustment: 24 Effective length of query: 235 Effective length of database: 233 Effective search space: 54755 Effective search space used: 54755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory