Align arginine permease (characterized)
to candidate WP_047214727.1 PATSB16_RS13955 amino acid permease
Query= CharProtDB::CH_091699 (590 letters) >NCBI__GCF_001931675.1:WP_047214727.1 Length = 471 Score = 246 bits (628), Expect = 1e-69 Identities = 161/469 (34%), Positives = 233/469 (49%), Gaps = 28/469 (5%) Query: 81 NAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSL 140 ++ ++ LKQRH+ MIALGG IG GLF+G + +AGP A+IS+L G+L V + L Sbjct: 11 SSRLQHSLKQRHMSMIALGGVIGAGLFVGSGVVIHSAGPA-AIISFLITGALVVLVMRML 69 Query: 141 GEMATFIPVTSSFTVFSQRFLS--PAFGAA----NGYMYWFSWAITFALELSVVGQVIQF 194 GEMA +P SF +++ PA G G+MYW+ W I A+E ++QF Sbjct: 70 GEMACALPAVGSFYEYARLAFDDRPAAGELAGFLTGWMYWYFWVIVVAVEAVAGASLVQF 129 Query: 195 WTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGV 254 W VP + V++T+ NL V YGEFEFW ASIKV AI+ FL V G Sbjct: 130 WLPGVPAWTISLVLLVLLTLTNLVSVASYGEFEFWFASIKVAAIVVFLFLGGLYVLGLWP 189 Query: 255 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314 G G + P I +S + A + G E+V I A EAA P Sbjct: 190 HATGGLSNITAHGGFMPNGIGPV---------LSGAVAATGFYFGAEIVTIAAAEAAEPH 240 Query: 315 KSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVL 374 ++V RA V+ R+L FY+GS+L + LVP+N + +P++ A+E Sbjct: 241 QAVARATNSVIGRVLFFYVGSILLVVALVPWNSAGMA--------TPYVSALEAIHIPAA 292 Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFG 434 +I NAV+LT ++SA NS +Y SR+LF L++ AP L+R GVP A+ FG Sbjct: 293 ANIMNAVVLTAVLSALNSGLYASSRMLFALTRRGDAPAALARLNGRGVPVRAILAGTLFG 352 Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494 A + + DKVF +L+N G F ++ I++S +R L+ + R L + Sbjct: 353 YAAVVMSYVSPDKVFAFLVNSYGTVAIFVYVLIALSQLRLRARLERQAPER--LKVRMWC 410 Query: 495 MPGLAYYAATFMTIIIIIQGF--TAFAPKFNGVSFAAAYISIFLFLAVW 541 P L Y A M I+ F + P GV A ++ F ++W Sbjct: 411 FPWLTYVAIAGMLGIVTAMAFIPSQRTPLALGVVSLAILLAAFALRSIW 459 Lambda K H 0.325 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 691 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 590 Length of database: 471 Length adjustment: 35 Effective length of query: 555 Effective length of database: 436 Effective search space: 241980 Effective search space used: 241980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory