Align ABC transporter for L-asparagine and L-glutamate, periplasmic substrate-binding component (characterized)
to candidate WP_156884837.1 PATSB16_RS06995 transporter substrate-binding domain-containing protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_771 (304 letters) >NCBI__GCF_001931675.1:WP_156884837.1 Length = 257 Score = 92.8 bits (229), Expect = 7e-24 Identities = 73/231 (31%), Positives = 107/231 (46%), Gaps = 15/231 (6%) Query: 38 TITLGHRDASIPFSYIADASGKPVGYSHDIQLKIVEAIKKDLDMPNLQVKYNLVTSQTRI 97 +I +G PF + +GK G+ D+ +EAI K + V+ + I Sbjct: 21 SIVVGADTTFPPFE--TEVNGKVTGFDIDM----IEAIAK---AEGMTVEIKTMPFNGII 71 Query: 98 PLVQNGTVDVECGSTTNNVERQQQVDFSVGIFEIGTKLLSKKDSAYKDFADLKGKNVVTT 157 P +Q G+VD T R Q VDFS ++ G +L KKDS KDFADLKG V T Sbjct: 72 PSLQAGSVDAAVAGITIKKSRMQSVDFSDAYYKSGLSVLVKKDSKIKDFADLKGHVVATK 131 Query: 158 AGTTSERILKSMNADKQMGMNVISAKDHGESFQMLETGRAVAFMMDDALLAGEMAKAKKP 217 T+S + S D + +D ++Q LETG A A + D+ + K P Sbjct: 132 KATSSVDYMTSHGIDPNY---IKQFQDIDTAYQALETGGADAVVFDNPVNVN--FKTAHP 186 Query: 218 TDWAVTGTAQSNEIYGCMVRKGDAPFKKAVDDAIIATYKSGEINKIYEKWF 268 + V G + E YG V K D K ++D + KSGE ++++ K+F Sbjct: 187 -NVKVVGPLLTGEYYGIAVSKKDPTLVKKINDGLAKIKKSGEYHQLFVKYF 236 Lambda K H 0.315 0.131 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 257 Length adjustment: 26 Effective length of query: 278 Effective length of database: 231 Effective search space: 64218 Effective search space used: 64218 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory