Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_047213390.1 PATSB16_RS07005 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_001931675.1:WP_047213390.1 Length = 240 Score = 260 bits (664), Expect = 2e-74 Identities = 133/239 (55%), Positives = 170/239 (71%) Query: 23 IQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVD 82 I + ++K +G +L+ I+ V E +V+ GPSGSGKST +RC+N LEE SG+I + Sbjct: 2 INVKNLHKSFGHHEILKGIDNHVDAQEVVVVIGPSGSGKSTFLRCLNGLEEVTSGEIEIA 61 Query: 83 GIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYL 142 G++LT NI K+R VGMVFQ FNLF HLTILEN+T+ P V+K+ ++ + A L Sbjct: 62 GMKLTDPKTNIHKLRQHVGMVFQQFNLFKHLTILENITIGPRKVKKMSVEDSNKIARELL 121 Query: 143 EKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQ 202 KV + + YP QLSGGQQQRVAIAR+L M+P +MLFDEPTSALDPEM+ EVL M Sbjct: 122 AKVGLSGKESSYPDQLSGGQQQRVAIARALAMQPDVMLFDEPTSALDPEMVGEVLQVMKN 181 Query: 203 LAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFLSQIL 261 LA EGMTM+ VTHEMGFA+ V +RVIFM G IVE+ P + F NPQ+ERTK FL++IL Sbjct: 182 LAVEGMTMVVVTHEMGFAREVGHRVIFMDGGYIVEEGKPQEIFSNPQAERTKNFLAKIL 240 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 240 Length adjustment: 24 Effective length of query: 239 Effective length of database: 216 Effective search space: 51624 Effective search space used: 51624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory