Align Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)
to candidate WP_047216629.1 PATSB16_RS15000 amino acid ABC transporter ATP-binding protein
Query= TCDB::P0AAG3 (241 letters) >NCBI__GCF_001931675.1:WP_047216629.1 Length = 251 Score = 275 bits (704), Expect = 5e-79 Identities = 134/240 (55%), Positives = 175/240 (72%) Query: 2 ITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEITVD 61 IT++NV+KW+G VL D + ++ E VV+CGPSGSGKST+I+ +NGLE QQG+I V Sbjct: 11 ITMENVNKWFGKHHVLKDINLTIRDQEKVVICGPSGSGKSTMIRCINGLEEHQQGKIVVG 70 Query: 62 GIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAREKALKLL 121 G+ ++D+ L +R GMVFQ F LFPH++I++N TLA + V K A E A+ L+ Sbjct: 71 GVELSDELNSLDHVRGNAGMVFQSFNLFPHMTILDNCTLAPIHVRGMKKPHAEELAMSLM 130 Query: 122 ERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMVE 181 RV + A+K+PAQLSGGQQQRVAIARALCM P MLFDEPTSALDPEM+ EVLD M+E Sbjct: 131 ARVKIQDQAHKYPAQLSGGQQQRVAIARALCMQPKIMLFDEPTSALDPEMVKEVLDTMIE 190 Query: 182 LANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDAFFDDPKSDRAKDFLAKILH 241 L GMTM+ VTHEM FA+++A+RV+FMD G IVE F+ P++DR + FL++ILH Sbjct: 191 LTELGMTMLCVTHEMNFAKQIADRVVFMDNGSIVEAGTPSEIFEAPRTDRLRTFLSQILH 250 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 251 Length adjustment: 24 Effective length of query: 217 Effective length of database: 227 Effective search space: 49259 Effective search space used: 49259 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory